KEGG   Pantoea ananatis LMG 5342: PANA5342_0052Help
Entry
PANA5342_0052     CDS       T01728                                 

Gene name
xylA
Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:plf00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:plf00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54326..55648
Genome map
AA seq 440 aa AA seqDB search
MHAYFDQLDRVRYEGTKTTNPLAFRHYNPDEVIMGKTMAEHLRFAACYWHTFCWNGADMF
GAGAFDRPWQKAGEALDLAKLKADVAFEFFHKLNVPYYCFHDVDVSPEGDSLKSYRENLA
VMTDKLLEKQQETGLKLLWGTANCFTHPRYGAGAATSPDPEVFSWAASQVCSAMKATQTL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNVEANHATLAGHAFHHEIATAIALGVFGSVDANRG
DPQCGWDTDQFPVSVEENALVMYEIIKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKVAARMLSDGELDKRVAQRYSGWNGEFGQQILKGEFSLDALAAHAHQQQFNPQ
HNSGRQEQLENLVNHYLYDF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcttattttgaccagcttgatcgcgttcgctacgaaggaacaaaaaccaccaat
cctctggcgttccgccactacaatccggatgaagtgatcatggggaaaaccatggccgag
catctgcgcttcgccgcctgttactggcatacgttctgctggaacggtgccgatatgttt
ggcgcgggtgcgtttgatcgtccgtggcagaaagcgggcgaggcgctggatctggcaaaa
ctcaaagcggacgtggcgtttgagttttttcacaagctgaacgtgccctattactgcttc
cacgatgtagacgtgtcaccggaaggggattcgctgaaaagctatcgcgaaaacctggcc
gtcatgaccgataaactgctggaaaagcagcaggaaaccgggcttaagctgctgtggggc
acagcgaactgcttcacccatccgcgttatggtgcaggcgctgcaaccagtcccgatccg
gaggtgttttcctgggcagccagccaggtatgcagtgccatgaaagccacccagacgctg
ggcggcgaaaactatgtgctgtggggcggtcgcgaaggatacgaaaccctgttaaatacc
gacctgcgccaggagcgcgagcagatcggccgctttatgcaaatggtggtggagcacaag
cacaaaatcggcttccagggcacgctgctgatcgaacctaagccgcaggaacccaccaag
catcagtatgattatgatgtcgccacggtttatggcttcctgaagcagtttggtctggaa
aaagagattaaggtgaacgtcgaagcgaaccatgcgacgctggccggccacgctttccat
catgaaattgcaacggccattgcccttggcgtgtttggttcggtggatgctaaccgtggt
gatccgcagtgcggctgggatacggaccagttcccggtcagcgtggaagaaaacgcgctg
gtgatgtacgaaatcatcaaagcaggcggtttcacgaccggcggcctaaactttgatgcc
aaagtgcgccgtcagagcaccgataagtatgacctgttctatggtcatattggcgcgatg
gacaccatggcactggcgttgaaagtcgcggcgcgcatgctgtctgacggtgagctggat
aaacgcgttgcgcagcgctacagcggctggaacggtgagttcggccagcagattttgaaa
ggcgagttctctctggacgcgctggcggcccatgcgcatcagcagcagtttaacccgcag
cacaacagtggacgtcaggagcagctggaaaacctggtgaatcactatctctatgatttt
taa

DBGET integrated database retrieval system