KEGG   Pantoea ananatis LMG 5342: PANA5342_0133Help
Entry
PANA5342_0133     CDS       T01728                                 

Gene name
mutM
Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:plf00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    PANA5342_0133 (mutM)
Enzymes [BR:plf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     PANA5342_0133 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     PANA5342_0133 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
147796..148605
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGQTILHAVVRNARLRWPVSQEIQALSDQPVLSVQRRAKYLL
LELPHGWIIIHLGMSGSLRVLSEELPAAKHDHVDLVMSNGKVLRYTDPRRFGAWLWSSDL
ADSSVLAHLGPEPLSEAFSGDYLFEKSRGKRTVIKQWLMDNKIVVGVGNIYASESLFTAG
IIPDRPAMSLSHEDAAILANTIKAVLLRSIEQGGTTLRDFLQSDGKPGYFAQELQVYGRA
GEPCRACGTPIVSGKHGQRSTYWCPNCQH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttgccagaggtagaaaccagccgacgcggcattgagccacatctggttggt
cagacaattcttcacgcagtcgtgcgcaatgcgcgtttgcgttggccagtgtcacaagaa
atccaggcgttaagcgatcagcctgtgctgagcgttcaacgtcgtgccaaatacctttta
ctcgaattgccgcacggctggattattatccacctgggtatgtcaggcagtttacgtgtc
ctttcagaagagttgcccgcagccaaacacgatcatgtcgacctggtcatgagcaacggt
aaagtcctgcgctataccgatccccggcgttttggcgcctggctgtggagcagtgacctg
gccgacagtagcgtactggcacacctcggcccagagccgctgagtgaagcgttcagtggt
gactatctgtttgaaaaatcccgcggaaagcgaacggtgattaagcagtggctaatggac
aataaaattgtcgttggcgtgggtaacatctatgcgagtgagtcactgtttacggcaggg
atcattcctgatcgacccgcaatgagcctttcccatgaagatgcggcgatattagcgaac
accatcaaagcggtactgctgcgctcaatcgagcagggcggaacaacattacgcgacttt
ttacaaagtgatggcaaaccgggctattttgcacaagagctacaggtttatggtcgcgcg
ggagagccctgcagggcatgtggcacaccgattgtcagtggcaagcatgggcaacgcagt
acttattggtgccccaactgtcaacactaa

DBGET integrated database retrieval system