KEGG   Pantoea ananatis LMG 5342: PANA5342_0170Help
Entry
PANA5342_0170     CDS       T01728                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00010  Glycolysis / Gluconeogenesis
plf00051  Fructose and mannose metabolism
plf00562  Inositol phosphate metabolism
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01120  Microbial metabolism in diverse environments
plf01130  Biosynthesis of antibiotics
plf01200  Carbon metabolism
plf01230  Biosynthesis of amino acids
Module
plf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
plf_M00002  Glycolysis, core module involving three-carbon compounds
plf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA5342_0170 (tpiA)
   00051 Fructose and mannose metabolism
    PANA5342_0170 (tpiA)
   00562 Inositol phosphate metabolism
    PANA5342_0170 (tpiA)
Enzymes [BR:plf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PANA5342_0170 (tpiA)
Exosome [BR:plf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PANA5342_0170 (tpiA)
  Exosomal proteins of bladder cancer cells
   PANA5342_0170 (tpiA)
  Exosomal proteins of melanoma cells
   PANA5342_0170 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCF07563
Position
complement(182233..183000)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKHMTAELIDGLRKELSGVEGCGVAIAPPALYLDQAKHAISGSHIA
LGAQNVDVNLSGAFTGEVSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKYAVLKAAG
LVPVLCIGETEAENEAGKTEEVCARQLDAVLTTQGAEAFKDAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKKDAAIAEQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKQR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccactggttatgggtaactggaagttgaatggcagcaagcatatgacagcc
gaactgatcgacggtctgcgcaaagaactgtcgggcgttgagggttgtggcgtcgctatt
gcaccgcccgcgctctatcttgatcaggctaaacacgccatttccggtagccacatcgct
ctgggtgctcaaaacgttgatgtaaacctctctggcgcatttaccggcgaagtgtccgct
gaaatgctgaaagatatcggcgcgaaatacatcatcattggtcactcagaacgtcgcact
tatcacaaagagagtgacgagttcattgcgaaaaaatatgccgtgttgaaagccgctggc
ctggtgccggttctgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaaccgaa
gaagtctgtgcacgccagcttgatgcggtgctgaccacgcagggtgcagaagcgtttaaa
gacgcggtcatcgcttacgagccggtatgggcgatcggtaccgggaagtcagccacacct
gctcaggcgcaggcagttcacaaatttattcgtgaccacattgccaaaaaagatgcggct
atcgctgagcaagtgattattcagtacggcggctcagttaacgataaaaacgctgccgag
ctgtttactcagccggacatcgacggtgccctggttggcggcgcgtcgctgaaagccgat
gcgtttgccgtgatcgttaaagctgctgcggcggctaaacaacgctaa

DBGET integrated database retrieval system