KEGG   Pantoea ananatis LMG 5342: PANA5342_0176Help
Entry
PANA5342_0176     CDS       T01728                                 

Gene name
glpK1
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PANA5342_0176 (glpK1)
Enzymes [BR:plf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PANA5342_0176 (glpK1)
Exosome [BR:plf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PANA5342_0176 (glpK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(187539..189050)
Genome map
AA seq 503 aa AA seqDB search
MTTTDKKYIVALDQGTTSSRAVVLDHDANIVAVSQREFTQIYPKAGWVEHDPMDIWASQS
STLVEVLAHADIRSDEIAAIGITNQRETAIVWDKETGKPVYNAIVWQDPRTADYCNKLKK
EGLEEYIQHTTGLVINPYFSGTKVKWILDNVEGARERAKRGELLFGTVDTWLVWKMTQGR
VHITDYTNASRTMLFNIHKLEWDERMLEILDIPRAMLPEVKSSSEVYGQTNIGGKGGTRI
PIAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFMLMNTGTEAVTSTHGLLTTIACGPRGE
VNYALEGAVFIGGAAIQWLRDEMKLISDSADSEYFAMKVKDSNGVYMVPAFTGLGAPYWD
PYARGALFGLTRGANANHIIRATLESIAYQTRDVLEAMQNDANTRLQALRVDGGAVANNF
LMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQDLEEVRAKAVIEREFRPTLETT
ERNVRYAGWKKAVARAQAWEEQE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgactaccaccgataaaaaatacatcgtcgctctcgatcagggcacaaccagttcacgt
gctgtggtgctggatcacgacgctaacattgtggcggtatcgcaacgcgaatttacccaa
atctatccgaaagcgggctgggtagagcatgacccaatggatatctgggcatcacagagt
tctacgctggttgaagtgctggcacatgctgatattcgctccgatgaaatcgcggcgatt
gggattactaaccaacgtgaaaccgcgatcgtctgggataaagaaaccggtaagccagtc
tataacgccatcgtctggcaggatccccgtactgctgactactgtaataagctgaagaaa
gagggactggaagagtatatccagcacaccaccggtctggtgattaacccttacttttct
ggcaccaaagttaagtggatcctggataacgtagaaggcgcgcgcgagcgtgcaaaacgt
ggcgaactgctgtttggtacagtcgacacctggctggtgtggaaaatgacccaggggcgc
gtgcacatcaccgattacaccaacgcctcacgtaccatgctgttcaacatccacaagctt
gagtgggatgagcgcatgctggaaatcctggatatcccgcgtgcgatgctgccagaagtg
aaatcttcgtctgaagtgtatggtcagacaaacattggtggtaaaggcggtacgcgtatt
cctatcgcgggtatcgcaggcgaccagcaggctgcgctgtatggtcagctgtgcgttcag
ccgggtatggcgaaaaacacctatggcaccggctgctttatgctgatgaacaccggtacc
gaagccgtcacctcaacgcacggcctgctgaccactatcgcctgcgggccacgtggtgaa
gtcaactatgcactggaaggggcggtctttatcggcggcgcggccattcagtggttacgc
gatgagatgaagctgatcagcgattcggctgactcagaatacttcgcgatgaaagtgaaa
gattcaaacggtgtatatatggttcctgcctttactggcctgggtgcaccttactgggat
ccctatgcacgtggcgcgctgttcggcctgacacgtggtgcgaatgcgaaccacatcatc
cgtgcaacgctggagtccatcgcttatcaaacacgtgatgtcctggaagccatgcagaat
gatgccaacacgcgcctgcaggctctgcgtgtggacggaggagcagtagctaacaacttc
ctgatgcagttccagtcagacattcttggcacacgcgttgagcgacctgaagtgcgtgaa
gtcactgcgctgggtgccgcgtacctggcaggtctggcggtaggtttctggcaggatctg
gaagaagtccgtgccaaagccgtgattgagcgcgaattccgtccaacacttgaaaccacc
gagcgtaacgtccgttatgccggctggaagaaagctgtcgcgcgcgcgcaagcgtgggaa
gaacaagagtaa

DBGET integrated database retrieval system