KEGG   Pantoea ananatis LMG 5342: PANA5342_0176Help
Entry
PANA5342_0176     CDS       T01728                                 

Gene name
glpK1
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:plf00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(187539..189050)
Genome map
AA seq 503 aa AA seqDB search
MTTTDKKYIVALDQGTTSSRAVVLDHDANIVAVSQREFTQIYPKAGWVEHDPMDIWASQS
STLVEVLAHADIRSDEIAAIGITNQRETAIVWDKETGKPVYNAIVWQDPRTADYCNKLKK
EGLEEYIQHTTGLVINPYFSGTKVKWILDNVEGARERAKRGELLFGTVDTWLVWKMTQGR
VHITDYTNASRTMLFNIHKLEWDERMLEILDIPRAMLPEVKSSSEVYGQTNIGGKGGTRI
PIAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFMLMNTGTEAVTSTHGLLTTIACGPRGE
VNYALEGAVFIGGAAIQWLRDEMKLISDSADSEYFAMKVKDSNGVYMVPAFTGLGAPYWD
PYARGALFGLTRGANANHIIRATLESIAYQTRDVLEAMQNDANTRLQALRVDGGAVANNF
LMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQDLEEVRAKAVIEREFRPTLETT
ERNVRYAGWKKAVARAQAWEEQE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgactaccaccgataaaaaatacatcgtcgctctcgatcagggcacaaccagttcacgt
gctgtggtgctggatcacgacgctaacattgtggcggtatcgcaacgcgaatttacccaa
atctatccgaaagcgggctgggtagagcatgacccaatggatatctgggcatcacagagt
tctacgctggttgaagtgctggcacatgctgatattcgctccgatgaaatcgcggcgatt
gggattactaaccaacgtgaaaccgcgatcgtctgggataaagaaaccggtaagccagtc
tataacgccatcgtctggcaggatccccgtactgctgactactgtaataagctgaagaaa
gagggactggaagagtatatccagcacaccaccggtctggtgattaacccttacttttct
ggcaccaaagttaagtggatcctggataacgtagaaggcgcgcgcgagcgtgcaaaacgt
ggcgaactgctgtttggtacagtcgacacctggctggtgtggaaaatgacccaggggcgc
gtgcacatcaccgattacaccaacgcctcacgtaccatgctgttcaacatccacaagctt
gagtgggatgagcgcatgctggaaatcctggatatcccgcgtgcgatgctgccagaagtg
aaatcttcgtctgaagtgtatggtcagacaaacattggtggtaaaggcggtacgcgtatt
cctatcgcgggtatcgcaggcgaccagcaggctgcgctgtatggtcagctgtgcgttcag
ccgggtatggcgaaaaacacctatggcaccggctgctttatgctgatgaacaccggtacc
gaagccgtcacctcaacgcacggcctgctgaccactatcgcctgcgggccacgtggtgaa
gtcaactatgcactggaaggggcggtctttatcggcggcgcggccattcagtggttacgc
gatgagatgaagctgatcagcgattcggctgactcagaatacttcgcgatgaaagtgaaa
gattcaaacggtgtatatatggttcctgcctttactggcctgggtgcaccttactgggat
ccctatgcacgtggcgcgctgttcggcctgacacgtggtgcgaatgcgaaccacatcatc
cgtgcaacgctggagtccatcgcttatcaaacacgtgatgtcctggaagccatgcagaat
gatgccaacacgcgcctgcaggctctgcgtgtggacggaggagcagtagctaacaacttc
ctgatgcagttccagtcagacattcttggcacacgcgttgagcgacctgaagtgcgtgaa
gtcactgcgctgggtgccgcgtacctggcaggtctggcggtaggtttctggcaggatctg
gaagaagtccgtgccaaagccgtgattgagcgcgaattccgtccaacacttgaaaccacc
gagcgtaacgtccgttatgccggctggaagaaagctgtcgcgcgcgcgcaagcgtgggaa
gaacaagagtaa

DBGET integrated database retrieval system