KEGG   Pantoea ananatis LMG 5342: PANA5342_0293Help
Entry
PANA5342_0293     CDS       T01728                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:plf00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(319946..320923)
Genome map
AA seq 325 aa AA seqDB search
MSDFSLTQRPRRLRASASMRAMFQESSLSLNDLALPIFVEEGVDDYKDIQAMPGVRRIPE
KHLAYEIERIAKAGIRSVMTFGISHHTDATGSDAWNENGLVARMSKICKDTVPEMIVMSD
TCFCEYTSHGHCGVLCDHGVDNDATLINLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQA
LDAAGFTQTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPMNRREAIRESLIDAA
EGADALMVKPAGAYLDILRDIRERTELPLAAYQVSGEYAMIKFAAQAGAIDERNVVLESL
GAIKRAGADLIFSYFALELAENNLL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttttcccttacccaacgtcccagaagattgcgcgccagcgcgtcaatgcgt
gcaatgtttcaggagtccagccttagcctgaacgatttggccctgcccatttttgttgag
gaaggtgttgatgactataaagatattcaggccatgcctggcgtaagacgtattcctgaa
aaacatcttgcctatgaaattgaacgtatcgctaaggcgggcattcgctcggtcatgacc
ttcgggatttcccatcataccgacgcgaccggcagcgatgcgtggaatgaaaacggcctg
gtggcgcgtatgtcgaaaatctgcaaagacaccgtgcctgaaatgatcgtgatgtcggat
acctgcttctgcgaatacaccagccacggccactgtggcgtgctgtgtgaccacggcgtc
gataacgatgccaccctgatcaatctaggcaagcaggccgttgtggcggcggcggcgggg
gccgactttatcgcgccttctgccgcaatggatggccaggttcaggcgatacgccaggcg
ctggacgccgcaggctttacccagacagcgatcatgtcttattccaccaagtttgcatca
tccttctatggccccttccgggaagcggcaggtacggccctgaaaggcgatcgtaaaacc
tatcagatgaacccgatgaatcgtcgtgaggctattcgcgagtcgctaattgacgcggct
gaaggtgccgatgcactgatggttaaaccggccggagcctatctggacattctgcgcgat
atccgcgagcgcaccgaacttccgctggcggcctatcaggttagtggtgagtacgcgatg
attaaattcgcggcccaggcgggcgccatcgatgagcgtaatgtcgtgctcgaaagcctt
ggcgcgatcaagcgggctggcgcagatttgattttcagctattttgcacttgagttggcc
gagaacaacctgctctga

DBGET integrated database retrieval system