KEGG   Pantoea ananatis LMG 5342: PANA5342_0354Help
Entry
PANA5342_0354     CDS       T01728                                 

Gene name
malQ1
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:plf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
390092..392164
Genome map
AA seq 690 aa AA seqDB search
MKSTSLDKAAQAAGIALTYFDANGEPEAISDDTKRALLGIMENPQKAGKSPLPPVVVFSG
NRKRELTPQMDGSFRWQLQTEKGKTLSGTLEGGAPFKLPSPLGQGYHQLTLSKGKREWQT
RVIVTPRRCYLPPALRAGEKRWGALVQLYTVRSEKNWGIGDFGDLEMLLEQLAARGGDFV
GLNPLHALYPSSPAFASPYSPSSRRWLNIIYIDVAQVADFQQSSAGQKWWKSAKTQKALK
QARESEWVDYDAVMALKITALRHGWARFQSRDAQDAQKQQFADFIQQGGDSLRYQAAYEG
LQAEMQGKGATHAGWPAWPERWRNSQSSDVQDWCAQHADEIAFWQWLQWLAQQQFSQCWA
RSQALGMSVGLYRDLAVGVAEGSAETWHDPELYRLKASIGAPPDRLGPLGQNWGLPPMDP
HVLQARGYQPFIDILRANMRDCGALRIDHVMALLRLWWVPAGETADKGAYVAYPVHDLLG
ILALESQRLRCMVIGEDLGTVPKEIVSLLRDSGVFSWKVLWFEQEKQGTYRAPQAYPRQS
IASASTHDLPTLTGFWSAGDLELGEKIGLYPDGQTVQNLQQQRMKQKQALLDALHKAGAV
PSRSAKRADALAMTAELNQSVHRFLADTNSALLGLQPEDWLGMTTPVNVPGTVDQYPNWR
RKLAQPLERIFADDNVNKLLETVTKRRKAG
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccacttcacttgataaagccgcccaggcggcgggaatagcgctcacgtatttc
gatgcgaacggtgaacctgaagccatcagcgatgataccaaacgcgccttactgggcata
atggaaaacccacagaaagccggtaaatctccgctgccccccgttgtggtttttagcggt
aaccgtaaacgcgagctgacgcctcagatggacggcagcttccgctggcagttgcagaca
gagaaaggcaaaacccttagcggaaccctcgaaggcggtgcgccctttaaactgccttcg
cctctggggcagggttatcaccagctgaccttgagcaagggcaagcgtgagtggcagacg
cgtgtgatcgtgacaccgcgccgttgttatctgccaccggccttgcgcgccggagagaaa
cgctggggggcgctggtgcagctttataccgtgcgttcagagaaaaactggggcatcggt
gattttggcgatctggaaatgttgctggagcagcttgccgcacgcggcggcgactttgtt
ggcctgaacccgttgcatgcgctctatccgtccagccccgcttttgccagcccctacagc
ccttcatcgcgccgctggctgaatattatttacatcgatgtggcacaggttgccgatttc
caacaaagcagcgcgggtcagaagtggtggaaaagtgccaaaacccaaaaggcgttaaag
caagcccgtgaaagcgaatgggtggattatgacgcggttatggcactgaaaattacggca
ttacgtcacggctgggcccggttccagtcgcgcgatgcgcaagacgcacagaagcagcag
tttgcggatttcatccagcaggggggcgacagcctgcgctatcaggcggcctatgagggt
ctgcaggctgaaatgcaggggaaaggtgccacgcacgcgggctggccggcctggcctgag
cgctggcgtaacagtcagtcttctgacgttcaggattggtgcgcgcagcacgcggatgag
attgccttctggcagtggttacagtggctggcacagcagcagttctctcagtgttgggca
cggagccaggcgctgggcatgagcgtggggctgtatcgtgatttagcggtcggtgtggcc
gaaggcagtgccgaaacctggcacgatccggagctgtaccgccttaaggcatcaattggc
gcgccgcctgacaggctggggccgttggggcaaaactgggggctgccgccaatggatcct
cacgtattgcaggccaggggctatcaaccatttattgatatcctgcgcgccaatatgcgt
gactgcggggcgctgcgtattgaccacgtcatggctctgctgcgcctctggtgggttccg
gcaggtgaaacggcggataaaggcgcctacgtcgcttaccctgtgcacgatctgcttggc
attctggcgctggaaagccagcgtttgcgctgtatggtgattggtgaggatctcggtacg
gtacctaaagagatcgtcagcctgctgcgcgacagcggcgtgttttcctggaaagtcttg
tggtttgagcaggaaaaacaggggacttaccgtgccccccaggcctatccacgccagtcc
attgccagcgccagtacgcacgatcttcccacgttgaccggcttctggagtgcaggtgat
ttagagcttggcgagaaaatcgggctttatccagacgggcaaacggtacagaacctgcag
cagcagcggatgaagcaaaaacaggccttactggatgctctgcataaagcgggagccgta
ccgtcgcgcagcgcaaagcgggcggatgctctggcgatgacggccgaactgaatcagtcc
gttcaccgttttctggcggacacgaacagtgcgctgctggggctacagccggaagactgg
ctggggatgacgacgccggtgaatgtgccgggtacggtcgatcaatatcccaactggcgg
cgcaagctcgcgcagccgctggaacgcatttttgccgacgataacgtgaataaactgctg
gaaaccgtgactaaacgacgcaaggcaggataa

DBGET integrated database retrieval system