KEGG   Pantoea ananatis LMG 5342: PANA5342_0359Help
Entry
PANA5342_0359     CDS       T01728                                 

Gene name
ycjM
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PANA5342_0359 (ycjM)
Enzymes [BR:plf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     PANA5342_0359 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(394767..396452)
Genome map
AA seq 561 aa AA seqDB search
MEKITALIDKIYADAFPQAMRERLLATIVEARDTTKLPRKAHWDEQDVVLITYADQFREP
GKPTLNTFSRFYQQHLHATFPLVHLLPFYPYSSDDGFSVINYHQVDPLCGDWQDIALLHQ
ETRLMFDFVCNHMSAHSAWFKHYLAQDEGWDDFFISLPPTTDLSAVTRPRTSPLLTPFTL
ENGEIRFVWTTFSADQIDLNFARPRVLVRMVEVLLDYLKRGADYVRLDAVGYMWKTPGTN
CIHLEKTHLLVKLFRAIADVVAPGTVIITETNVPHKDNISYFGNGQDEAQMVYQFSLPPL
VLHAIHTGSARALRQWASTLQVGNGDTTFFNFLASHDGIGLNPARGILSEVEITALVRDL
ALEGALISYKNNPDGSTSPYEINVTYFDALNREGDDDETRLKRFMLAHAILLAFPGVPAV
YIQSILGSRNDYDGVREAGHNRAINRQKYSLSAIEDALVNSDGLRHQVYTRLSKLIQQRR
RQTAFHPDNPLTLFQSDNALLIMKRYSHNGGDELLCVFNLSGRQIEARLPEAHLFQDVVS
GEKIDGTQPVTLDAWQFMWLR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatcactgctttaatcgataagatttatgccgatgcctttcctcaggctatg
cgcgaacgcctgctcgccacgatcgttgaagcccgtgacaccactaagctgccgagaaag
gcccactgggatgagcaggacgtggtgctgattacgtatgccgatcagttccgcgagccg
ggcaaacccacactcaacaccttttcacgtttctaccagcagcatttgcacgccacgttt
ccgctggtgcacctcctgccgttttatccctattcgtctgacgacggcttttcggtcatt
aactaccatcaggtcgatccgctgtgtggcgactggcaggacattgccttactgcatcag
gaaacgcgcctgatgttcgactttgtctgtaaccatatgtcagcgcatagtgcgtggttt
aaacattatcttgctcaggatgaaggctgggatgatttttttatcagcctgccgcccacc
accgacctcagcgcggtcacgcggccaagaacgtcaccgttgctcaccccctttacgctg
gaaaacggtgaaatccgctttgtctggaccacgttcagtgccgatcagattgaccttaac
tttgcccgtcccagggtgctggtgcgcatggtagaggtgctactcgactatctgaaacgt
ggcgcggactatgtgcgactggatgcggtgggatacatgtggaaaacgccaggcacgaac
tgtattcacctcgaaaaaacgcatctgctggtcaaactgtttcgcgccattgccgacgtg
gtcgcacccggcaccgtcatcatcaccgaaacgaatgtgccgcacaaagacaacatcagc
tactttggtaacgggcaagacgaagcccagatggtgtatcagttttccttgccgccgctg
gtgctacacgccatccacaccggatcggctcgcgctctgcgtcaatgggccagcaccctg
caggtgggcaatggcgatacaaccttttttaacttcctggcctcgcacgatggtataggt
cttaatccggcacgcgggattttatcggaggtggagatcacggcgctggtgcgcgatctg
gcactggagggggcgctgatctcctataaaaacaatcctgacggcagcaccagcccatac
gaaatcaacgtgacctatttcgacgcgcttaaccgcgaaggcgatgacgacgaaacgcgc
ctcaaacgctttatgctggcgcatgctattttactggcctttccgggtgttccagccgtc
tatattcaaagcatcctgggatcgcgtaatgactatgacggcgtacgtgaggcaggccat
aaccgggccattaaccggcaaaaatattcgctctccgctatcgaagacgcactggtgaac
agcgacggcttacgccatcaggtttatacccggctgagcaaactgattcagcagcgtcga
cgccagacggcctttcatcccgacaacccgttgacgttgtttcagagcgataatgccctg
ctcatcatgaagcgttattcgcataacggcggtgatgaattactgtgtgtgtttaatctc
agtggcaggcagattgaagcccggttaccggaggcgcatctttttcaggatgtggtaagc
ggtgagaaaattgatggcacccagccagtaacgctggatgcctggcaattcatgtggcta
cgataa

DBGET integrated database retrieval system