KEGG   Pantoea ananatis LMG 5342: PANA5342_0645Help
Entry
PANA5342_0645     CDS       T01728                                 

Gene name
nucD
Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
plf  Pantoea ananatis LMG 5342
Brite
Enzymes [BR:plf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PANA5342_0645 (nucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
667308..667817
Genome map
AA seq 169 aa AA seqDB search
MSQTAKRCAVAAVLALAALLPQINMLKTSEAGLKLIADAEGCRTSPYQCSAGVWTNGIGH
TQGVTTTSVVNERQAAVNLVYDVMRVERGIDQCMPREMPFQVYDAVVSFGFNVGVHAACH
STLAGLINSGRWHDACLQLKRWVYVKGTYNPGLDNRRQREMAWCLKGAA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
ttgagccagaccgctaaacgttgcgccgtggcggccgtactggccctggccgcgttgcta
ccgcaaatcaacatgctgaaaacctctgaagccggcctgaagctgattgccgatgcagaa
ggctgccgcacctcgccctatcagtgcagcgccggcgtctggaccaacggcattggtcac
acgcaaggtgttaccacgaccagcgtggtgaacgagcgccaggccgcggtaaacctggtt
tacgacgtgatgcgcgttgaacgcgggatcgaccagtgcatgccacgtgaaatgccgttc
caggtttatgacgcggtggtgtcattcggttttaacgttggcgtgcacgccgcctgtcac
tcaacgctggcgggattgatcaacagcggccgctggcacgatgcctgcctgcagcttaag
cgctgggtatatgtcaaaggcacctacaacccgggcctggataaccgtcgccagcgcgaa
atggcgtggtgtttaaaaggagcggcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system