KEGG   Pantoea ananatis LMG 5342: PANA5342_0766Help
Entry
PANA5342_0766     CDS       T01728                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PANA5342_0766 (deoA)
Enzymes [BR:plf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PANA5342_0766 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
789780..791108
Genome map
AA seq 442 aa AA seqDB search
MYLAQEIIRKKRDGHALSEDEIRFFINGVRDNSVSEGQIAALAMTIYFHDMSLPERVALT
MAMRDSGTVLNWKSLNLNGPVVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLEAIPGFDIFPSDDHFRQTIKQVGVAIIGQTNSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYEASENLAQAIVGVANGAGCRTTALLT
DMNQVLASTAGNALEVREAVRFLTGAQRNPRLLEVTLALCSEMLISGKLAENEAEAREKL
MTVLDNGKAAEVFARMVAAQKGPTDFVERYDSYLPAPTMSKAVYADRAGCVTHMDTRALG
MAVVAMGGGRQRASDAIDYSVGLSDMITLGEQVDASRPLAVIHASSEAHWQQAAAAVKAA
ITLGERAPAATPVVYRRVTEAG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtaccttgcacaagaaatcattcgaaaaaaacgtgacggccacgcgctgagtgaagac
gagattcgtttcttcattaacggcgtgcgtgataacagcgtttcggaaggacaaattgcc
gcgctggcaatgaccatttattttcacgatatgtcgctgccggagcgggttgccctgacg
atggcgatgcgtgactcaggcaccgtgctgaactggaaatccctgaatctgaacgggccg
gtggtcgataagcactccaccggcggcgtcggcgatgtcacctcgttgatgctggggccg
atggtggccgcctgtggcggctatatcccgatgatctcaggtcgcgggctggggcacacc
ggcggcaccctggacaagctggaagcgattcccgggtttgacattttccccagtgatgac
cactttcgccagaccataaagcaggttggcgtggcaattattggccaaaccaactccctg
gctccggcggacaaacgcttttacgccacgcgcgacatcacggccaccgtggattcgatt
ccgctgatcaccgcctcgattctggcgaaaaagctggccgaagggctggatgcgctggtg
atggatgtcaaagtcggctccggggcatttatgcccacgtatgaagcctctgaaaatctg
gcgcaggccattgttggcgtcgccaacggcgcgggctgtcgcaccacggcgctgttaacg
gatatgaaccaggtgctggcctccacggccggtaacgcgctggaagtgcgcgaagcagtg
cgcttcctgaccggtgcgcagcgtaacccgcgcctgctggaagtgacgctggcgctgtgc
agcgaaatgctgatctccggcaaactggcggaaaatgaggctgaggcacgcgaaaaactc
atgacggtgctggataacggcaaggccgcagaggtgtttgcccgcatggtggcggcgcag
aagggcccgaccgattttgttgagcgctacgacagctatttgcctgcgccaacgatgagc
aaagcggtttatgccgaccgggcaggctgtgttacccatatggatacccgcgcgctgggc
atggcggtggtggcgatgggcggtggacgccagcgcgccagtgatgccatcgattacagc
gtgggcctgagcgacatgatcaccctgggcgagcaggtggatgcttctcgtccgctggcg
gtcatccatgccagcagcgaagcgcactggcaacaggccgctgccgccgtaaaagccgcg
attaccttgggtgaacgcgccccggcagccacgcctgtcgtgtatcgccgcgtcactgag
gcaggctga

DBGET integrated database retrieval system