KEGG   Pantoea ananatis LMG 5342: PANA5342_0901Help
Entry
PANA5342_0901     CDS       T01728                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
plf  Pantoea ananatis LMG 5342
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
920445..921158
Genome map
AA seq 237 aa AA seqDB search
MNKHVAMLALLASAFSGLTHADDSAIQLSLKKLGLHQAEIQPAPLPGFKTVLTESGVLYV
TDDGKHMIQGPLYDVSGAQPVNVTNALLDKKVEALVPEMIVYKAPKEQHVVTVFTDITCG
YCHKLHEQMADYNALGITVRYLAFPREGMNGKVASAMKAVWCSADRNKAFDEAMKGDVPK
MDAPASCTIDIGKQYQLGVLFGIQGTPAILTDSGMMIPGYQSPQELKQVLDNQKRGG
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacatgttgccatgctggcgctgctggccagcgctttttccggtttgacccac
gctgatgacagcgccattcagctttccctgaagaaactgggtttgcaccaggctgagatc
caacctgcaccgctgccgggttttaaaaccgtgctcaccgaaagcggcgtgctgtatgtt
accgatgatggtaaacacatgatccaggggccgctttacgatgtcagcggtgctcagccg
gtcaacgtgacgaacgcgctactggataaaaaagttgaggcgctggttccggaaatgatc
gtgtataaagcgcccaaagagcagcacgtggtgacagtgtttacggatatcacctgtggc
tactgccacaaactgcacgaacaaatggctgactacaacgcgctgggcatcaccgttcgc
tatctggctttcccacgtgaaggcatgaacggcaaagttgccagcgccatgaaggccgtg
tggtgcagcgccgatcgcaacaaagcctttgatgaggcgatgaaaggcgatgtgccgaag
atggatgcgccagcctcctgcacgattgatatcggcaagcagtaccagcttggcgtactg
tttggtatccagggcacgccggcgattctgaccgatagtggcatgatgatccccggctat
caaagtccacaggagctcaagcaggtactggataatcaaaagcgtggtggttaa

DBGET integrated database retrieval system