KEGG   Pantoea ananatis LMG 5342: PANA5342_0926Help
Entry
PANA5342_0926     CDS       T01728                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:plf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
951003..952850
Genome map
AA seq 615 aa AA seqDB search
MSDINALLLQAVEKRLLRPLDIQFARLIADDAQPFLLLAAACVSADAGEGHVCLPLANLS
ETGLFAGRQPALAQALWQAAGAPDDVHAALAGWSAISDGSAVTPLVLSHERLYLHRLWQS
EGQVARFFSLQPDEGTFDAHRASEVLTSLFGSRPDDWQKIAAAVALTRKTAVISGGPGTG
KTTTVAKLLAALIRLNTVPLRIQLAAPTGKAAARLTESLGKALQGLAVSEEERARFPAEA
TTLHRLLGAQPDTQRLRYHAGNLLHLDVLVVDEASMVDLSMMAKLISALPQHARVVFLGD
RDQLASVEAGAVLGDICRCSETGFSPSRAAQLTALTGCTLTGDDVEAAPAVRDSICLLRQ
SYRFDEKSGIGQLARAVNQGDARRMSAIFAAGHQDVSFQPLNDGDAYQAMLDEVARGYSD
YLHAVQHQATPEQVIDAFSRYQLLCALREGPFGVHGLNQRIEQRLMQLQRIRRPALGSRW
YAGRPVMITRNDSALGLFNGDIGITLRDEEGQLRVFFPLPDGSVKAIQPSRLPSHETAWV
MTVHKSQGSEFDHTALVMPTQFLPVLTRELVYTAITRARSQLTLYSDRAIFDRAVQLQTQ
RRSGLVERLGAAGQA
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatataaacgccttactgctccaggcagtcgaaaagcgtttactgcgtcctctg
gatatacagtttgcccgcttgattgcggacgacgcccagccttttctgctgctggcagcg
gcctgcgtcagtgccgatgccggagaaggtcacgtctgtctgccgctggctaatctgagc
gagaccggactctttgcggggcgtcagccggcgctggcccaggcactgtggcaggccgca
ggcgcgccggacgatgtgcatgctgcactggcgggctggtcagcaatcagtgatggcagt
gccgttacgccgctggtgctgagccatgagcgtttgtatctgcatcgcttgtggcagagc
gaagggcaggttgcgcgctttttttcgttgcagcccgacgaaggaacatttgatgcgcac
cgggccagcgaggtactgaccagcctgtttggcagccgtcctgacgactggcaaaagatt
gccgcagccgtggcgctgacgcgaaaaaccgccgtgatttcaggtgggccgggaaccggt
aaaaccaccacggtggcaaagctgctggctgcgttaatccgattgaatacggtgccgctg
cgcatacagctggcggcgcccacgggcaaagccgcggcccgtttaacggagtcgctgggt
aaagctctacagggactggccgtgagcgaggaagagcgcgcccggttccctgcggaagcg
acgacgctgcaccgcctgctgggtgcacaaccggacacgcagcgtctgcgctatcacgcg
ggcaatctgttgcatctggatgtgctggtggtcgatgaggcctcaatggtcgacctgagc
atgatggcaaaactgatctctgccttgccacagcatgcgcgcgtggtctttctgggcgat
cgcgatcagctggcttcggtggaggcgggcgccgtgctgggggatatttgccgctgcagc
gaaacaggatttagcccgtcacgggctgcacagctgacggccctgaccggctgcacgctc
acaggcgacgatgttgaggccgcgccagccgttcgcgacagcatttgcctgctgcgacag
agctatcgttttgatgaaaagtccggaataggtcagctggcacgggcggtgaaccagggc
gatgcgcgccggatgagcgcgatttttgccgccggacaccaggatgtttcttttcagccg
ctgaacgacggcgacgcttatcaggctatgctggacgaggtagcgcggggttatagcgat
tatctgcatgccgttcagcatcaggctacgccagagcaggtcattgacgcattcagccgt
tatcagctgttgtgtgccctgcgtgaagggccctttggcgtgcacgggctgaatcagcgc
attgagcaacgcctgatgcagctgcagcgcatcagacgtcctgcgttgggcagccgctgg
tatgcgggaaggccggtaatgatcacccgtaatgacagcgcactggggctgtttaacggc
gatatcggtattactctgcgcgatgaggaaggccagctcagagtcttttttccgttacca
gacggcagcgtgaaagcgattcagcccagccgtttgccgtctcatgaaaccgcctgggtt
atgacggtacataagtcgcagggatcggagtttgaccataccgcgctggtcatgccgacc
cagtttctgccggtgctgacccgcgagctggtttataccgcaattacgcgtgcgcgcagt
caactgacgctttacagcgatcgtgcaatatttgaccgcgccgtacagctgcaaacgcag
cggcgaagcgggctggtggagaggttaggggcggccgggcaggcgtaa

DBGET integrated database retrieval system