KEGG   Pantoea ananatis LMG 5342: PANA5342_1361Help
Entry
PANA5342_1361     CDS       T01728                                 

Gene name
fadJ
Definition
fatty acid oxidation complex, subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PANA5342_1361 (fadJ)
   01212 Fatty acid metabolism
    PANA5342_1361 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PANA5342_1361 (fadJ)
   00650 Butanoate metabolism
    PANA5342_1361 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    PANA5342_1361 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    PANA5342_1361 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PANA5342_1361 (fadJ)
   00310 Lysine degradation
    PANA5342_1361 (fadJ)
   00380 Tryptophan metabolism
    PANA5342_1361 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PANA5342_1361 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PANA5342_1361 (fadJ)
   00281 Geraniol degradation
    PANA5342_1361 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PANA5342_1361 (fadJ)
Enzymes [BR:plf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PANA5342_1361 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PANA5342_1361 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PANA5342_1361 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1409302..1411422
Genome map
AA seq 706 aa AA seqDB search
MEQSAFTLQMRDDHVGVITIDVPNEKMNTLKAAFAAQIAVIIAEARKHPQLLGLVLISGK
PDNFIAGADISMIDRCQSAHEAEALARQGQDVMAAIAALPFPVVAAIHGACLGGGLELAL
ACNARICSLDDKTRIGLPEVQLGLLPGSGGTQRLPRLIGVQKALPLILTGKNLRARQAKK
LGIVDDAVPQAILLDAAVELVKKGKYRRAPLPLRDRLLQGPMARQALFALVRRETDRKTQ
GNYPAARRIIEVVRIGLEQSSQAGYAAEARAFGELAMTPESAALRSLFFASTAIKKENGT
QAEPRPLQRVGVLGGGLMGGGIASVSAVNAGLPVRIKDISLKGINHALQTSWDLLSKKVK
RRQISPAQRQQQMARISGSTDYQGFTQRDIVIEAVFEDLDLKRQMVADIEANCQPQTIFA
SNTSSIPIAEIAATARRPENIIGLHYFSPVEKMPLVEVIPHATTSPETIASTVMLARKQG
KTPIVVADKPGFYVNRILTPYINEAMRCVVEGEPIDHIDRALVKAGFPVGPVQLLDEVGI
DVGSKISPGLQQAYGERFAAPSALDAVIKDGRKGRKNGRGFYLYGSSRLARKKVDPAVYG
LVKTRPVAKQSGVQIAERCMMMMLNEAVRCLDEQVIRSPRDGDIGAVFGIGFPPFLGGPF
HYIDRLGAAEIVNRLTRLQQQYGDRFAPCNALLRAAEQQKKFYTSS
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaacagagcgcgttcacattacagatgcgggacgatcatgtaggcgtgatcaccatt
gatgtacccaatgaaaagatgaatacgcttaaagcggcattcgcggcacagattgcggta
attattgcggaagcacgcaagcatccgcaactgctggggctggtgctgatttcaggcaaa
cctgacaactttattgcaggggctgatatcagcatgatcgatcgctgccagagcgcccac
gaggcagaagcgctggccagacaagggcaggacgtgatggcggcgattgcggcattgcca
tttcctgtggtggcggcaatccatggtgcttgtctgggcggcgggcttgagctggcgctg
gcctgcaacgcgcgcatctgttcgctggacgataaaacccgtattggcctgcctgaagtg
cagttggggctgctgccggggtcgggcggcacgcagcgcctgcctcgcttaatcggcgta
cagaaagccttaccgcttatccttaccggtaagaacctgcgggccaggcaggcgaaaaag
ctgggcattgttgatgatgccgtgccgcaggccatcctgcttgacgccgccgttgaactg
gtgaagaaagggaaataccgcagagcgccgctgcccctgcgcgatcgtctgttgcagggc
ccgatggctcgtcaggcgctgttcgcactggtcagacgcgaaaccgatcgtaaaacccag
ggtaactacccagcggcacgacgcattatcgaggtggttcgcatcggcctggagcagagc
agccaggccggttacgccgcggaagcgcgggcgtttggcgaactggcgatgacgccagag
tcggccgcgctgcgcagcctgttttttgcttccaccgccatcaagaaagagaacggcacc
caggctgaaccacgaccactccaacgggtcggtgtgctgggcggcgggctgatgggcggc
gggatcgccagcgtcagcgccgttaatgcggggctaccggtacgcatcaaggatatcagt
cttaaaggcatcaaccatgccctgcaaaccagttgggatctgctgagtaaaaaagtgaaa
cgccggcaaatcagtccggcacagcgtcagcagcagatggcgcgcatcagcggcagtacc
gactatcagggattcacccagcgcgatatcgtgattgaggcggtctttgaggacctggat
ctgaaaagacagatggtggcggacatcgaggcgaactgtcagcctcagacgatctttgct
tccaatacctcatcgattcccattgccgagattgcggcgacggcacggcgcccggagaac
atcatcggcctgcactattttagcccggtggaaaaaatgccgctggtcgaggtgatcccg
catgccacgacatcgcctgaaacgattgccagtacggtaatgctggcacggaaacagggt
aaaacgccgatagtggtggccgataaacctggtttttacgtcaaccgtatcctcacacct
tacatcaacgaggccatgcgctgcgtggtggagggggaaccgatcgatcacattgatcgg
gcgctggtgaaggcgggattcccggtggggccggttcagctactggatgaagttggcatt
gatgtcggcagtaagatttcaccgggcctgcagcaggcttatggcgagcggtttgccgcg
ccttccgcgctggatgccgtgatcaaagacggtcgcaaaggacgcaaaaacggtagggga
ttctacctgtacggatcgtcgcgtctggcgcgtaaaaaggtcgatccggcggtgtacggc
ttagtgaagacccggccggtggcaaagcaaagcggcgtccagattgccgaacggtgcatg
atgatgatgttaaacgaagcggtgcgttgcctggatgagcaggttatccgctcgccgcgg
gacggcgatatcggtgcggtatttggcattggtttccccccctttttgggcggcccgttc
cattatatcgacaggctgggcgcggcagaaatcgtcaacagattaacgcggcttcagcaa
cagtacggggaccgttttgcgccctgtaacgcgttactgcgcgcagcggagcagcagaaa
aagttttacacttcttcataa

DBGET integrated database retrieval system