KEGG   Pantoea ananatis LMG 5342: PANA5342_1533Help
Entry
PANA5342_1533     CDS       T01728                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:plf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1615271..1615936
Genome map
AA seq 221 aa AA seqDB search
MSTLSQEAAQVHEALLARGLETPLRAPTREIDDETRKSLIAGHMTEIMQLLNLDLEDDSL
METPHRIAKMYVDEVFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVIIDG
KATVAYIPKDKVIGLSKINRIVQFFAQRPQVQERLTQQVLLALQTLLGTNNVAVSIDAVH
YCVKARGVKDATSATTTTSLGGLFKSSQNTRQEFLRAVRHN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttgagtcaggaagctgcacaggtccacgaagcgctgctggcgcgtgggctg
gaaacgccgctgcgcgcacccacgcgtgaaatagacgatgaaacgcgtaagagcctgatt
gcaggccatatgacggaaatcatgcagctgctgaatctggatcttgaagatgacagcctg
atggaaaccccgcatcgcatcgccaaaatgtatgtcgatgaggtcttttccggtctcgat
tatgccaacttccccaaaatcacgctcatcgaaaacaagatgaaagtggatgagatggtg
acggttcgcgacattacgctgaccagcacctgcgaacatcattttgtgattatcgacggg
aaagccaccgtcgcgtatatccctaaagataaggtgatcggcttatccaagatcaaccgc
atcgtgcagttcttcgcgcagcggcctcaggtgcaggagcgtttaacacagcaggtcctg
ctggcgctgcaaacgctgttgggaacgaataacgttgccgtttcgatcgatgccgttcac
tactgtgtgaaagcgcgcggcgtgaaggatgccaccagcgccacgaccacgacctcgctg
ggtgggctgtttaaatccagtcaaaatacccgtcaggaattcctgcgcgcggtgcgtcat
aactaa

DBGET integrated database retrieval system