KEGG   Pantoea ananatis LMG 5342: PANA5342_1533Help
Entry
PANA5342_1533     CDS       T01728                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00790  Folate biosynthesis
plf01100  Metabolic pathways
Module
plf_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PANA5342_1533 (folE)
Enzymes [BR:plf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PANA5342_1533 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CCF08926
Position
1615271..1615936
Genome map
AA seq 221 aa AA seqDB search
MSTLSQEAAQVHEALLARGLETPLRAPTREIDDETRKSLIAGHMTEIMQLLNLDLEDDSL
METPHRIAKMYVDEVFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVIIDG
KATVAYIPKDKVIGLSKINRIVQFFAQRPQVQERLTQQVLLALQTLLGTNNVAVSIDAVH
YCVKARGVKDATSATTTTSLGGLFKSSQNTRQEFLRAVRHN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttgagtcaggaagctgcacaggtccacgaagcgctgctggcgcgtgggctg
gaaacgccgctgcgcgcacccacgcgtgaaatagacgatgaaacgcgtaagagcctgatt
gcaggccatatgacggaaatcatgcagctgctgaatctggatcttgaagatgacagcctg
atggaaaccccgcatcgcatcgccaaaatgtatgtcgatgaggtcttttccggtctcgat
tatgccaacttccccaaaatcacgctcatcgaaaacaagatgaaagtggatgagatggtg
acggttcgcgacattacgctgaccagcacctgcgaacatcattttgtgattatcgacggg
aaagccaccgtcgcgtatatccctaaagataaggtgatcggcttatccaagatcaaccgc
atcgtgcagttcttcgcgcagcggcctcaggtgcaggagcgtttaacacagcaggtcctg
ctggcgctgcaaacgctgttgggaacgaataacgttgccgtttcgatcgatgccgttcac
tactgtgtgaaagcgcgcggcgtgaaggatgccaccagcgccacgaccacgacctcgctg
ggtgggctgtttaaatccagtcaaaatacccgtcaggaattcctgcgcgcggtgcgtcat
aactaa

DBGET integrated database retrieval system