KEGG   Pantoea ananatis LMG 5342: PANA5342_1591Help
Entry
PANA5342_1591     CDS       T01728                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PANA5342_1591 (galF)
   00052 Galactose metabolism
    PANA5342_1591 (galF)
   00500 Starch and sucrose metabolism
    PANA5342_1591 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    PANA5342_1591 (galF)
Enzymes [BR:plf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PANA5342_1591 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1682916..1683812
Genome map
AA seq 298 aa AA seqDB search
MTKLKAVIPVAGLGMHMLPATKAIPKEMLPVVDKPMIQYIIDECVAAGIKEIVLVTHASK
NAVENHFDTTYELEALLEARVKRQLLSEVQSICPPGVTIMNVRQAQPLGLGHSILCARPM
IGDNPFVVVLPDVLLDDSTADHLRYNLAAMVARFEETGHSQVLAKHLTDYDLSEYSVITT
EQPLENPGDVSTITDFVEKPEHPAELNSDLAAVGRYVLSADIWAELERTEPGAWGRIQLT
DAIASLSKKKTVDVSLMTGHSFDCGRKMGYMQAFVSYGLRNNAQGRDFREAIEKILAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcttaaagcagtaatcccggttgcgggtctcggtatgcatatgcttccggcg
actaaagccattccgaaagagatgctgcctgtcgtggacaagccaatgattcaatacatc
attgatgagtgtgttgcagcagggatcaaagagattgtgctggtcacccatgcgtccaag
aatgcggtagaaaaccacttcgataccacctatgaacttgaagccctgctggaagcacgc
gttaaacgccagctgctgagtgaagtccagtcaatctgcccgccgggcgtgaccatcatg
aacgtgcgtcaggcgcagccactgggcctggggcattctattctctgcgcgcgtcctatg
atcggcgacaatccttttgtggttgtcctgcctgacgtgctgttggacgattccaccgct
gaccatttacgatataatctggcggcgatggttgcgcgttttgaagagaccggtcacagc
caggtgctggcaaaacacctcaccgactacgatctgtctgaatactcagtgatcacgact
gagcagccgctggaaaacccaggtgatgtcagcacgattactgacttcgttgagaaacct
gagcatccggccgagttaaactcagacctggcagcggtgggacgctacgtgctttcagcc
gatatctgggctgagctggagcgtaccgaaccgggcgcatggggccgtattcagttaacg
gatgctatcgccagcctgagtaagaagaaaacggtcgatgtctcactcatgacgggtcac
agtttcgactgcggacgtaaaatgggttacatgcaggcatttgtctcctacggtctgcgc
aataacgctcagggccgcgacttccgcgaagcgatcgagaaaattctggcgaagtaa

DBGET integrated database retrieval system