KEGG   Pantoea ananatis LMG 5342: PANA5342_1882Help
Entry
PANA5342_1882     CDS       T01728                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
plf  Pantoea ananatis LMG 5342
Brite
Enzymes [BR:plf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PANA5342_1882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1992838..1993326
Genome map
AA seq 162 aa AA seqDB search
MAISPALRKSLITAAGGGALAIAAVLIPSLEGNSYTPYRDVGGVWTVCNGITGPDVIQGK
IYTQKECDALLQKHLQPYARSVERSVKVPSNSYQKAALISFSYNVGVNAFEHSSVLRNLN
AGRYQQACDGLRSWVYVDRVRIQGLADRRDVEREICNWSLSP
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggctatttcacccgctttacgtaaaagcctcatcacagctgctggtggtggtgcgtta
gccatcgcggctgttctgatcccgagcctcgaaggcaattcttacacgccatatcgtgac
gtcggcggcgtctggactgtatgcaacggcattaccggcccggatgttattcaggggaaa
atctatacacagaaagaatgcgacgcgctactgcaaaagcacctgcagccctatgcccgg
tctgtggaacggtctgtaaaggtgccgtcgaattcatatcagaaagccgctcttatcagt
tttagctataacgtcggcgttaatgcattcgagcattcatcggtactgcgcaacctgaat
gccggtcgctatcagcaagcctgcgatggccttcgtagctgggtatacgttgatcgcgtg
aggattcaggggctggcggaccgccgtgacgttgagcgggagatctgcaactggagcctg
agcccatga

DBGET integrated database retrieval system