KEGG   Pantoea ananatis LMG 5342: PANA5342_2060Help
Entry
PANA5342_2060     CDS       T01728                                 

Gene name
yeaD
Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:plf00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2163574..2164452)
Genome map
AA seq 292 aa AA seqDB search
MQDKLFSLPVIKQITPYLSQRQVGELPTIVVSHPRVRAAITLQGAHLIAWQPSGEKPVLW
LSDKSPFSPGKAIRGGIPICWPWFGPAGEPAHGFARNQSWTLSAHDENEDGVILTLVLES
NPQTLKLWPHEFTLIARFRLGQHCEIELEAYGDYTSTAALHSYFNVADINGVEVSGLGEH
YIDKVNDNQPGTGDGKQRFTTRVDRIFTSANDCSVINDQAGKRQIEVYHHHHSDVVTWNP
GVELSCSMTDMPNEGYKTMVCVETARISKPLRSAGEKPARLATTIRLKGKVN
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacaaacttttttctcttcccgtcattaaacagattacgccttacctgtcacag
cgtcaggtgggcgaacttccgactatcgtcgttagtcatccccgcgtgcgcgcagctatc
acgttacagggcgcgcatctcatcgcctggcagcccagcggggagaaacctgtcctgtgg
ctaagtgacaaaagccccttctcaccaggcaaagcgattcgaggcggcattcccatttgc
tggccctggtttggccccgcaggtgaacccgcacacggttttgcccgtaaccagtcgtgg
acgctgtccgcccatgacgaaaacgaagatggcgttatcttgacgctggtgctggaaagt
aatccgcaaaccttaaagctgtggccacatgaattcacgttaatcgcccgtttccgcctg
gggcagcactgtgagatcgaactggaagcctatggcgactacacgtccaccgccgccctg
cacagctactttaacgtggcggatatcaacggcgtagaggtgtcgggtctgggtgagcac
tatatcgacaaggttaacgacaatcagccaggcacgggcgacggcaaacagcgctttacc
accagggttgaccgtattttcacctcggccaatgactgttcggtgattaacgatcaggct
ggaaagcgccagattgaagtctatcaccaccatcatagtgacgttgtcacgtggaacccc
ggcgtcgaactctcctgcagtatgacggacatgcccaacgaagggtataaaaccatggtg
tgcgtggaaacggcgcgaatcagcaaaccgttacgcagcgcgggcgaaaaaccggcccgg
ctggccaccacgatccgtctgaaagggaaagtgaattaa

DBGET integrated database retrieval system