KEGG   Pantoea ananatis LMG 5342: PANA5342_2064Help
Entry
PANA5342_2064     CDS       T01728                                 

Gene name
ydjB
Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:plf00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2166642..2167250)
Genome map
AA seq 202 aa AA seqDB search
MKRALIIIDIQNDFCPGGPMAVREGDHTVAVANRYARAFHEKGECVVALQDWHPANHGSF
ASVSGEPVYTLGELNGLPQIWWPDHGVQHSAGADFHPGLDRSLFDAVFHKGQDQDVDSYS
AFFDNGHRRKTELDSWLRERGISHLVMLGLATDYCVKYSVLDALELGYQVDVVAEGCRGV
NLNPEDSDIALAQMAAQGAVIV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggcactgatcattatcgatattcagaacgacttctgccccggcggcccaatg
gccgtgagagaaggcgatcacaccgtcgcggtagcaaatcgctatgcccgtgcctttcat
gagaaaggcgaatgcgtagtggccttgcaggactggcacccggccaatcatggcagcttt
gcttctgtctcgggcgagccggtttataccctgggtgagctcaacggtttgcctcaaatc
tggtggcccgatcatggtgttcagcattcggcgggcgctgattttcatcctggtctcgat
cgcagcctgtttgatgctgtttttcacaagggccaggatcaggatgtcgacagctacagc
gctttttttgataacggccatcgccgtaaaacggagctggacagctggttacgtgaacgc
ggcatcagccatctggttatgctggggctggcaaccgattactgtgtgaaatacagcgtt
ctggatgcactggaactgggctatcaggtggacgtggtcgccgaaggctgccgcggggtg
aatttgaatcctgaagacagcgacatcgcactggcccagatggccgcccagggtgcggtc
attgtctga

DBGET integrated database retrieval system