KEGG   Pantoea ananatis LMG 5342: PANA5342_2076Help
Entry
PANA5342_2076     CDS       T01728                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PANA5342_2076 (galU)
   00052 Galactose metabolism
    PANA5342_2076 (galU)
   00500 Starch and sucrose metabolism
    PANA5342_2076 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PANA5342_2076 (galU)
Enzymes [BR:plf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PANA5342_2076 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2178723..2179631
Genome map
AA seq 302 aa AA seqDB search
MSAYKTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNAIENHFDTSFELESMLEKRVKRQLLDEIQSICPPHVTIMQVRQGIAKGLGHAVM
CAHPLVGDEPVAVILPDVIIDEYESNPTKDNLAEMLSRYEESGRSQIMVEPVSDVTAYGV
VDCQGAELNPGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSADIWPLLAKTPPGAGGEVQ
LTDSIAMLMDKETVEAYHLKGVSHDCGNKLGYMQAFVEYGVRHPVLGKEFTEWLNNTVSD
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctataagaccaaagtaaaaaaagcggtaattccagtagcgggtttgggtaca
cgtatgttgcctgctaccaaagcgattccaaaagaaatgttgccgctggttgataagccg
ttaattcagtatgtcgttaacgagtgtattgctgcgggtattaatgagattgtgctggtt
actcactcctctaaaaacgccattgagaaccattttgataccagttttgaactggagtct
atgctggaaaaacgcgtcaagcgccagctgctggacgaaattcagtccatctgtcctcct
cacgtgaccatcatgcaggtccgtcagggcatcgcgaaaggtctgggccatgcggtcatg
tgtgcacatcctctggtcggcgatgaacctgttgcggtcatcctgcctgacgtgatcatc
gacgaatacgaatctaacccaaccaaagataacctggcagaaatgctgagccgttacgaa
gagtctggccgtagtcagatcatggttgagcccgtcagcgatgtgacggcatacggtgtt
gtggattgtcagggtgcagaactgaatcctggtgacagcgcgcctatggtcggggttgtt
gagaaacctaaagcgtctgaagcgccatccaaccttgcggttgtcggtcgttacgttctg
tctgcggatatctggccactgctggcgaaaacgcctccaggtgccggtggcgaagttcag
ctcaccgactccatcgccatgctgatggataaagaaaccgtcgaagcctatcacctgaaa
ggggtaagccacgactgtggtaacaaactgggttatatgcaggctttcgttgaatatggt
gtccgccatccggtattgggtaaagagttcactgaatggctcaacaatactgttagcgat
aaaaagtaa

DBGET integrated database retrieval system