KEGG   Pantoea ananatis LMG 5342: PANA5342_2076Help
Entry
PANA5342_2076     CDS       T01728                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase GalU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00040  Pentose and glucuronate interconversions
plf00052  Galactose metabolism
plf00500  Starch and sucrose metabolism
plf00520  Amino sugar and nucleotide sugar metabolism
plf01100  Metabolic pathways
plf01130  Biosynthesis of antibiotics
Module
plf_M00362  Nucleotide sugar biosynthesis, prokaryotes
plf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PANA5342_2076 (galU)
   00052 Galactose metabolism
    PANA5342_2076 (galU)
   00500 Starch and sucrose metabolism
    PANA5342_2076 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PANA5342_2076 (galU)
Enzymes [BR:plf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PANA5342_2076 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CCF09469
Position
2178723..2179631
Genome map
AA seq 302 aa AA seqDB search
MSAYKTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNAIENHFDTSFELESMLEKRVKRQLLDEIQSICPPHVTIMQVRQGIAKGLGHAVM
CAHPLVGDEPVAVILPDVIIDEYESNPTKDNLAEMLSRYEESGRSQIMVEPVSDVTAYGV
VDCQGAELNPGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSADIWPLLAKTPPGAGGEVQ
LTDSIAMLMDKETVEAYHLKGVSHDCGNKLGYMQAFVEYGVRHPVLGKEFTEWLNNTVSD
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctataagaccaaagtaaaaaaagcggtaattccagtagcgggtttgggtaca
cgtatgttgcctgctaccaaagcgattccaaaagaaatgttgccgctggttgataagccg
ttaattcagtatgtcgttaacgagtgtattgctgcgggtattaatgagattgtgctggtt
actcactcctctaaaaacgccattgagaaccattttgataccagttttgaactggagtct
atgctggaaaaacgcgtcaagcgccagctgctggacgaaattcagtccatctgtcctcct
cacgtgaccatcatgcaggtccgtcagggcatcgcgaaaggtctgggccatgcggtcatg
tgtgcacatcctctggtcggcgatgaacctgttgcggtcatcctgcctgacgtgatcatc
gacgaatacgaatctaacccaaccaaagataacctggcagaaatgctgagccgttacgaa
gagtctggccgtagtcagatcatggttgagcccgtcagcgatgtgacggcatacggtgtt
gtggattgtcagggtgcagaactgaatcctggtgacagcgcgcctatggtcggggttgtt
gagaaacctaaagcgtctgaagcgccatccaaccttgcggttgtcggtcgttacgttctg
tctgcggatatctggccactgctggcgaaaacgcctccaggtgccggtggcgaagttcag
ctcaccgactccatcgccatgctgatggataaagaaaccgtcgaagcctatcacctgaaa
ggggtaagccacgactgtggtaacaaactgggttatatgcaggctttcgttgaatatggt
gtccgccatccggtattgggtaaagagttcactgaatggctcaacaatactgttagcgat
aaaaagtaa

DBGET integrated database retrieval system