KEGG   Pantoea ananatis LMG 5342: PANA5342_2081Help
Entry
PANA5342_2081     CDS       T01728                                 

Gene name
adhE
Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PANA5342_2081 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA5342_2081 (adhE)
   00620 Pyruvate metabolism
    PANA5342_2081 (adhE)
   00650 Butanoate metabolism
    PANA5342_2081 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    PANA5342_2081 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PANA5342_2081 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PANA5342_2081 (adhE)
   00626 Naphthalene degradation
    PANA5342_2081 (adhE)
Enzymes [BR:plf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PANA5342_2081 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PANA5342_2081 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2183790..2186477)
Genome map
AA seq 895 aa AA seqDB search
MAVTNVAELNALVERVKKAQQEFANFSQQQVDAIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLDTDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDIIGWIDAPSVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADVKRAVASILMSKTF
DNGVICASEQSVIVVDAVYDAVRERFASHGGYLLQGQELSAVQNIILKNGGLNAAIVGQP
AVKIAEMAGISVPGETKILIGEVERVDESEPFAHEKLSPTLAMYRAKDYQDAVSKAEKLV
AMGGIGHTSCLYTDQDNQTARVHYFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEIATDGAK
RAFVVTDRFLFNNGYADQVTRVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKARMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPRSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKENLPASYAEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANSLLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLTAPGDRTAQKIEKLLVWLDEIKTELGIPASIREAGVQEADFLAKVDKLADDAFDDQ
CTGANPRYPLIAELKQLMLDSYYGRKFVEPFASAAEAAQAQPVSDSKAAKKAKKA
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggccgttactaatgtcgctgaactcaatgcactggttgaacgtgtaaaaaaagcccag
caagaattcgccaatttttctcaacaacaggtcgatgccatcttccgcgcagccgcactg
gccgccgcggatgcccgaattccactcgctaaaatggcggtggcagaatcgggcatgggc
attgttgaagacaaagtcattaaaaatcacttcgcttctgaatacatctacaacgcctat
aaggatgagaaaacctgcggcgtactggacaccgatgatacgtttggcaccatcaccatc
gctgaacccatcggcctgatttgcggtatcgtccccaccactaaccctacctccaccgcg
attttcaaggcacttatcagccttaaaacccgcaacgggattatcttctccccccatcct
cgagccaaagatgcgacgaataaagcggcggatattgtcctgcaggcagcgattgccgct
ggcgcgcccaaagacattataggctggattgatgcaccttcagtggaactgtccaatcag
ttgatgcaccaccctgatattaacctgattctggcgacgggtggtcccggcatggttaaa
gcggcctacagctcaggtaagccggcgattggcgtgggggccggtaacacgcccgttgtc
atcgatgaaacagctgatgttaaacgcgccgttgcctccatcctgatgtcaaaaacgttt
gataacggtgtgatctgtgcctctgaacagtcggttatcgtggtggatgccgtctacgac
gccgtgcgcgagcgcttcgccagccatggtggctatctgcttcagggacaggagctgagt
gcggtacaaaatatcattctaaaaaacggtgggcttaacgccgccattgtgggccagcct
gcggtgaagattgcggagatggccggcatcagcgtacctggtgaaaccaaaatcctgatt
ggcgaagttgaacgggtcgatgaatcagagcctttcgctcatgaaaaactgtcgccgaca
ctggcgatgtaccgtgctaaagattatcaggatgccgtcagcaaagcggagaaactggtg
gcgatgggtggtattggtcatacgtcatgcctgtataccgaccaggacaatcagacagcg
cgcgtgcactattttggcgacaagatgaaaacagcccgcattctgatcaacacgccagct
tctcagggcggtattggtgatttatataacttcaaactcgccccttctctgacactgggt
tgtggttcctggggcggtaactccatttctgaaaacgtggggcccaaacatctcatcaac
aagaaaaccgtcgctaagcgagctgaaaatatgttgtggcataaacttccgaagtccatt
tactttcgtcgcggctctttacccattgcgcttgaagagatcgccactgacggtgccaaa
cgcgcgtttgtggtgactgaccgcttcctgtttaacaacggttatgccgatcaggtcacc
cgcgttttaaaatctcacggcatcgaaaccgaagttttctttgaggttgaagcggatccc
accttaagcatcgtgcgtaaaggtgcagaacagatgaacagctttaagccagacgtgatc
atcgccctgggcggcggttcgccgatggatgcagccaaaatcatgtgggtcatgtatgag
catcctgaaacccattttgaagagctggcactgcggtttatggatattcgcaaacgtatc
tataagttccctaaaatgggcgtgaaagcgcgcatggtggccattacgacaacctcaggc
acaggttcagaagtgacgccttttgccgtggtaacggatgacgcgaccggacagaaatac
ccgctggccgattatgcgctgacgccggatatggctatcgttgatgccaacctggtcatg
gatatgccacgttcactttgtgctttcggcggtctggatgcggtgacgcacgcgctggaa
gcctatgtgtccgttctggccaatgaatactccgatggtcaggccctgcaggcgcttaag
ctgcttaaagagaacttaccggcgagttatgcagaaggtgcaaaaaatccggttgcccgt
gaacgtgtacataatgccgccaccatcgccggtatcgcctttgcgaacgccttcctcggg
gtttgtcactcaatggcgcataagcttggctctgagttccatattcctcatggactggct
aactcgctgctgatttccaacgttattcgctataacgccaatgacaaccctactaagcaa
accgcattcagccagtacgatcgtccccaggcgcgtcgtcgttatgctgaaattgcggat
catcttggtctcaccgcgccgggcgaccgcactgcccagaaaattgagaagctgctggta
tggctggatgaaatcaaaacggaactgggtattccggcctcgattcgtgaagccggtgtg
caggaggcagacttcctggcgaaagttgataaactggcggatgatgcctttgatgaccag
tgtactggcgcgaatccacgttatccgctgattgccgaactcaaacagctgatgctggac
agctactacggccgtaaatttgtcgagccgttcgccagtgccgccgaggctgctcaggct
caacctgtcagtgacagcaaagcggcgaagaaagctaaaaaagcctaa

DBGET integrated database retrieval system