KEGG   Pantoea ananatis LMG 5342: PANA5342_2102Help
Entry
PANA5342_2102     CDS       T01728                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha TrpA
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PANA5342_2102 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA5342_2102 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA5342_2102 (trpA)
Enzymes [BR:plf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PANA5342_2102 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2203001..2203804)
Genome map
AA seq 267 aa AA seqDB search
MERYDRLFSRLAEKKEGVFVPYITLGDPSPDLSLRIIDALVEGGADALELGIPFSDPLAD
GPTIQGAGLRAFAAGTTTTQCFEIIASVRQKYPELPIGLLMYANLVFNNGIEEFYTRCEQ
AGVDSVLIGDVPVEESAPFRQAAMRHNIAPIFFCPPNADDELLRQISSHGRGYIYVLSRA
GITGAENRANLPLKHLIDKMREYNAPPSLQGFGISEPSQVKEVIDAGVAGAISGSAVVKI
IEKNLAQPEVMLNELKDFVSRMKAATR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttacgatcgactgttttcacgtctggcagagaagaaagaaggcgtgtttgtg
ccttacattactctgggagatccttctccagacctatcactacgcattattgatgccctt
gttgaaggtggcgctgatgctcttgagctcggtattcccttctctgacccgctcgctgac
ggaccaactattcagggcgcaggccttcgcgcctttgccgctggcaccaccacaacacaa
tgctttgagataattgcaagcgtacgccagaaataccctgaactgccgattggcttgctg
atgtatgcgaatttagtctttaacaatggcatcgaagagttttatacacgctgtgaacaa
gcaggggttgattccgtattaattggtgatgttcccgtagaagagtctgccccattccgc
caggctgccatgcgccacaacatcgcccctattttcttctgcccgccaaatgcagatgat
gaacttctgagacaaatatcttcacatggtcgtgggtacatttatgtgctttcacgagct
ggcattaccggtgctgaaaatcgcgccaacctgcctctaaagcatttgatcgataaaatg
cgtgagtacaatgcgccaccatccttacaaggttttggcatctccgaaccttctcaggtg
aaagaagtcattgatgcaggcgtggctggggcgatttcaggttctgccgtagtaaaaatt
atcgagaaaaacctggctcagcccgaagtgatgctgaatgaattaaaagactttgtctca
agaatgaaagccgccacccgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system