KEGG   Pantoea ananatis LMG 5342: PANA5342_2102Help
Entry
PANA5342_2102     CDS       T01728                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain TrpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00260  Glycine, serine and threonine metabolism
plf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01130  Biosynthesis of antibiotics
plf01230  Biosynthesis of amino acids
Module
plf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA5342_2102 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA5342_2102 (trpA)
Enzymes [BR:plf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PANA5342_2102 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: CCF09495
Position
complement(2203001..2203804)
Genome map
AA seq 267 aa AA seqDB search
MERYDRLFSRLAEKKEGVFVPYITLGDPSPDLSLRIIDALVEGGADALELGIPFSDPLAD
GPTIQGAGLRAFAAGTTTTQCFEIIASVRQKYPELPIGLLMYANLVFNNGIEEFYTRCEQ
AGVDSVLIGDVPVEESAPFRQAAMRHNIAPIFFCPPNADDELLRQISSHGRGYIYVLSRA
GITGAENRANLPLKHLIDKMREYNAPPSLQGFGISEPSQVKEVIDAGVAGAISGSAVVKI
IEKNLAQPEVMLNELKDFVSRMKAATR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttacgatcgactgttttcacgtctggcagagaagaaagaaggcgtgtttgtg
ccttacattactctgggagatccttctccagacctatcactacgcattattgatgccctt
gttgaaggtggcgctgatgctcttgagctcggtattcccttctctgacccgctcgctgac
ggaccaactattcagggcgcaggccttcgcgcctttgccgctggcaccaccacaacacaa
tgctttgagataattgcaagcgtacgccagaaataccctgaactgccgattggcttgctg
atgtatgcgaatttagtctttaacaatggcatcgaagagttttatacacgctgtgaacaa
gcaggggttgattccgtattaattggtgatgttcccgtagaagagtctgccccattccgc
caggctgccatgcgccacaacatcgcccctattttcttctgcccgccaaatgcagatgat
gaacttctgagacaaatatcttcacatggtcgtgggtacatttatgtgctttcacgagct
ggcattaccggtgctgaaaatcgcgccaacctgcctctaaagcatttgatcgataaaatg
cgtgagtacaatgcgccaccatccttacaaggttttggcatctccgaaccttctcaggtg
aaagaagtcattgatgcaggcgtggctggggcgatttcaggttctgccgtagtaaaaatt
atcgagaaaaacctggctcagcccgaagtgatgctgaatgaattaaaagactttgtctca
agaatgaaagccgccacccgctaa

DBGET integrated database retrieval system