KEGG   Pantoea ananatis LMG 5342: PANA5342_2104Help
Entry
PANA5342_2104     CDS       T01728                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01130  Biosynthesis of antibiotics
plf01230  Biosynthesis of amino acids
Module
plf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA5342_2104 (trpC)
Enzymes [BR:plf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PANA5342_2104 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     PANA5342_2104 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C HHH_4
Motif
Other DBs
NCBI-ProteinID: CCF09497
Position
complement(2205042..2206403)
Genome map
AA seq 453 aa AA seqDB search
MQGTVLDKIVKDKAVWVEARKQQQPLESFQQRVALSSRSFYDALQGTRTAFILECKKASP
SKGLIRDDFDPEMIAGVYRHYASAVSVLTDEKYFQGDFAFLPVVSAAITQPVLCKDFIID
PYQIYLARYYQADAILLMLSVVDDEQYRQLAAIAHSLQMGVLTEVSNEQELERAIALEAK
VVGINNRDLRDLSIDLNRTRELAPRLGPGVTVISESGINNYRDVRELSHFANGFLIGSAL
MEEEDLHAAVRRVTLGSNKVCGLTRPEDACAACEAGAIFGGLIFVEGSPRQVDTERARAV
MAGAPLKYVGVFRDAAISDIVTKTEALQLSAVQLHGDEDPAYVAELYQALPENVQIWKAL
SIQTTLPERRWPHVDRYVFDNGNGGSGQTFDWSLLKGQDLKNVLLAGGLSADNCVEAAQL
GCAGLDFNSGVESEPGIKDASKIASVFRTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcagggtacagtgttagataaaatcgtgaaagacaaagccgtttgggttgaggcgcgt
aagcagcagcaacctctggagagtttccagcagcgagtggcgctttccagccgtagtttt
tatgacgcactgcagggcacccgcactgcctttattctggaatgcaaaaaagcctctcca
tccaaagggcttattcgtgatgattttgatcctgagatgatagccggggtttatcgccac
tatgcctctgccgtttccgtattaacggacgagaaatactttcagggtgacttcgccttt
ttgcccgtcgtcagcgcagccattacgcagccggtcctgtgcaaagattttattatcgat
ccgtatcaaatttacctggcgcgttactaccaggcggatgccatcctgctgatgctctct
gtggttgacgacgagcagtatcgccagctggccgccattgcgcacagcctgcagatgggc
gtcctgactgaagtcagtaacgagcaggagctggaacgcgcgattgcgctggaagccaaa
gtggtcggcatcaacaaccgtgacttacgcgatctctccatcgaccttaaccggacccgt
gaactggccccgcgcctgggccccggcgtcaccgtgatcagcgagtcgggcatcaacaac
taccgggatgtccgcgagttaagccactttgcgaatggtttcctcatcggctctgcgcta
atggaagaagaggatcttcatgccgccgtgcgccgcgtcaccttaggcagcaataaagtc
tgcggtctgacccgtcctgaagacgcctgcgcggcctgcgaggcaggtgccatttttggt
ggtttgatctttgttgaaggttcgccgcgtcaggttgataccgagcgtgcacgcgcggtc
atggctggcgcaccgctgaagtatgttggcgtgttccgcgatgccgctataagtgacatt
gtcaccaaaacagaggcgttacagctgagtgccgtgcaactgcatggcgatgaagacccg
gcctatgtggctgagctttatcaggcgctgccagaaaacgtgcaaatctggaaagcgctc
agcatccagacgaccctgcccgaacgtcgctggccccatgttgaccgctatgtcttcgat
aacggcaacggtggctcgggccagacatttgactggtcgctgctaaaaggacaggacctg
aagaatgttctgctggcaggaggactgagcgctgacaactgcgtcgaagccgctcagtta
ggctgtgcagggctggatttcaattcgggcgtggaaagcgagccgggtattaaagacgcc
agcaaaattgcctcggtattccggacgcttcgcgcctactga

DBGET integrated database retrieval system