KEGG   Pantoea ananatis LMG 5342: PANA5342_2274Help
Entry
PANA5342_2274     CDS       T01728                                 

Gene name
malQ3
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PANA5342_2274 (malQ3)
Enzymes [BR:plf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PANA5342_2274 (malQ3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2384148..2386199
Genome map
AA seq 683 aa AA seqDB search
MKPLHYPAGIGRVATEYVDAHGAVRQVSASTRDRLLAAMQPGPGPGVIPPVAVFTQGLPI
RLTPSLAGPARWHLEGESGERWSGHCEPEASLTLPALPEGYHLLTINADAQQSRCQIIVT
PSRCYEPEALLRGERRWGTCVQLYALRSDQNWGIGDFADLRDMVKAVGMRGGAFVGLNPL
HALFPALPDDASPYSPSSRRWLNVLYISVPEVEDFNLSAAAQCWWQSDETQHRLHQARHA
PWVDYSTVASLKLDALRFAWQQFMQRDKEDSQVEAFEAFVAEGGESLLHQGLFDALQAWL
REEDPLRHGWQTWPTAYQQPDTAAVHAFRIENGDEIRFYLWLQWLAARQFAACWHLCQQH
QMAPGLYRDLAVGVAAGGSETWSQRGLYCLAASTGAPPDILGPLGQNWGLPPMDPQSLYD
RAYEPWITLLRANMRDCGALRIDHVMALLRLWWIPQGETAAAGAYVAYPIDDLLAILALE
SQRQRCMVIGEDLGTVPEAIVDKLHNAGVYSYKVLYFEQNSHKGFRPPAAWPRQAMAVAT
THDMPTLRGWWQSDDLTLGSQLGLYPDKAVLAGLYHQRRAARSALLQTLTRHGYLKPKGR
VQANSPRMSLLLNQVIHQYLADCTSALLGLQPEDWLDMASPVNVPGTVEAYPNWRRKLNL
SLEAMFADKRITALLEEISRRCS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacttcattatccggccgggatcggcagggtagccactgaatatgttgatgcg
catggggcggtccggcaggtttctgcatcgacccgcgatcgcttgctggcggcgatgcag
ccgggccctggccctggcgttatcccaccggtcgccgtctttacccagggtttgcccatc
cgtttaacgccctctctggctggcccggcacgctggcacctggagggcgaatcgggtgaa
cgctggtcagggcactgcgagcctgaggcgtctttgacgctcccggcgctgcctgaaggt
taccatcttctgacgataaacgcggatgcacagcaatcgaggtgccagataatagtgaca
ccgtcacgttgctatgagccggaggccttgctacggggcgagagacgctggggaacctgt
gtccagctctacgctttacgatcggatcagaactggggaatcggcgattttgctgacctg
cgggacatggtgaaggcggttggcatgcgcggcggcgcttttgtggggctgaatcccctg
catgcgctttttcctgcgttacctgatgatgccagcccctatagcccgtcttcccggcgc
tggctcaacgtgctctatatcagcgttcctgaggttgaggactttaacctgagtgccgct
gcgcagtgctggtggcagtcggatgaaacgcaacacaggctgcaccaggcgcgtcacgcg
ccctgggtcgattattcgacggtggcatcacttaagctggatgccctgcggtttgcctgg
cagcagtttatgcagcgtgataaagaggatagtcaggtcgaggcatttgaggcgtttgtg
gctgagggcggtgaaagtctgctgcatcagggattgttcgatgccctgcaggcctggctt
cgcgaagaagatcccctgcgtcacggctggcaaacgtggcccactgcctatcaacaaccc
gatacggccgccgtacacgcgtttcggattgaaaatggcgatgagattcgtttctatctc
tggctgcaatggctggcggcgcgtcagtttgccgcctgttggcacctgtgccagcagcac
cagatggcacctggactttatcgcgatttggccgttggcgtcgccgcagggggatcggaa
acctggagccaacgcgggctttactgtttagcggccagcacaggcgccccgccggatatt
ctgggcccgcttggccagaactgggggctgccgccaatggacccgcaatctttgtatgat
cgggcatatgaaccctggattacgttgctgcgtgcgaatatgcgcgattgtggggcgtta
cgtatcgatcatgtcatggctttgctgcgactgtggtggattccgcaaggagaaacggcc
gccgcaggcgcgtatgtcgcctatcccattgacgacctgctcgctattctggcgctggaa
agtcagcgccagcgctgcatggtgattggtgaggatttaggcacggtgccggaggcgatt
gtcgataaactccacaatgctggcgtctactcgtataaggtgctctattttgagcaaaac
tcgcacaagggctttcgcccacctgcggcatggccgcgtcaggcaatggctgtagccacc
actcacgatatgccaacgctccgtggctggtggcaaagtgacgatctgacactggggagc
caactggggttgtatcctgataaagcggtgcttgccgggctgtatcatcagcgccgggca
gcccgatcggcgctgcttcagaccctgacgcgccacggttacctcaagcccaaagggcgg
gttcaggcaaacagtccgcgcatgagtctgttacttaaccaggttatccatcagtatctc
gcggactgcaccagcgccctgctgggtttacaacccgaagactggctggatatggcctcg
ccggttaatgtgccgggcacggtagaggcttatccgaactggcggcgtaagctaaacctg
tcgctggaggcgatgtttgcagataagcgtatcacggcattgctggaggagatttcccgg
cgttgttcgtga

DBGET integrated database retrieval system