KEGG   Pantoea ananatis LMG 5342: PANA5342_2335Help
Entry
PANA5342_2335     CDS       T01728                                 

Gene name
pfkA3
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PANA5342_2335 (pfkA3)
   01230 Biosynthesis of amino acids
    PANA5342_2335 (pfkA3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA5342_2335 (pfkA3)
   00030 Pentose phosphate pathway
    PANA5342_2335 (pfkA3)
   00051 Fructose and mannose metabolism
    PANA5342_2335 (pfkA3)
   00052 Galactose metabolism
    PANA5342_2335 (pfkA3)
  Energy metabolism
   00680 Methane metabolism
    PANA5342_2335 (pfkA3)
Enzymes [BR:plf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PANA5342_2335 (pfkA3)
Protein phosphatases and associated proteins [BR:plf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PANA5342_2335 (pfkA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2441048..2442028)
Genome map
AA seq 326 aa AA seqDB search
MRIGMVISGGDVTGINNFIFQIARMTQAEMILFNGGIPGLLDNVCQEISQRDLVDFSITS
LPVMQSGRTARKLIRSEYETIARQLKALRIDVLILAGGDGSLQFLHTLSEFGVNCFGIGM
TIDNDVYGSDYTVGFSTACEQVLKEVAKLRNTGRALTGRVFMVELLGGYCGELTLQSALK
SNADFALIPECQIPTNVLAERITQRLSEQNSVVILCSEGYTREYSPGFQGAIDTLIKQLE
PLIGVRIRKTIVGYGLRNGDPTCEEIYQGTIMASEVVRCIQSGMRNKAVIINGSNKPIPI
DLISMKKRLVDTEGHHYKLAKQLHIL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcggaatggtcattagcggcggcgacgtcaccggcattaataatttcattttc
cagatagccaggatgacgcaggcggagatgatattatttaacggcggcattccaggcttg
ctggataatgtctgccaggaaatttctcagcgcgatttagtggatttttccattacttct
cttccggtaatgcagtcaggccgaaccgcgcgaaaattaattcgtagcgaatatgaaacg
atcgcccggcagttaaaagcattacgcatcgacgtattaattctggctggaggcgacgga
tcgctgcaatttctgcatacgctcagtgaatttggtgtgaactgttttggcatcggcatg
acgattgacaacgatgtctacggcagtgattacaccgtgggcttttccaccgcctgtgag
caggtattaaaagaggtggcaaagctcagaaacaccggtcgggcattaacgggccgggta
tttatggtggaactgctcggcggctactgtggcgaattgacgctccagtcagcgctcaaa
tccaacgccgactttgcgctgatcccggaatgccagatccccacaaacgtgctggcagaa
cgcatcactcagcgcctcagcgaacaaaacagcgtggtaatcctctgctcagaaggttac
acacgggaatattcaccgggctttcagggggcgattgacacattaattaagcagcttgaa
ccgttgatcggcgtgcgcattcgcaaaacgatcgtcggctatggactgcgaaatggcgat
cccacctgtgaggaaatttatcagggcaccattatggcaagtgaagtggttcgttgtatt
caatccggaatgcgcaataaagccgtgattattaacggcagtaataagcctattccgatt
gacttaataagcatgaaaaaacgcctggtcgatacagaagggcatcattataaactcgct
aaacaactgcatatattgtga

DBGET integrated database retrieval system