KEGG   Pantoea ananatis LMG 5342: PANA5342_2512Help
Entry
PANA5342_2512     CDS       T01728                                 

Gene name
btuE
Definition
vitamin B12 ABC transporter
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:plf00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:plf00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2615338..2615883)
Genome map
AA seq 181 aa AA seqDB search
MSIYQTELVTLDGEKTALSSWQGQVLLVVNVASKCGLTPQYEALENIHKAWHEQGFSVLG
FPCNQFLEQEPGSSEEIKTFCSTTYGVTFPMFEKCEVNGEHRHPLYAQLVAAKPEAVRPE
ESGFYERMVSKGRAPKAPGDILWNFEKFLIGRDGSVIQRFSPDMSPEDPIILETIKQALA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttatcaaactgaactggttacactggatggtgagaaaacggcgctgtcctcc
tggcagggacaggtgctgctggtggtcaacgtggcctctaaatgcggcttaaccccacaa
tatgaagcgctggaaaatattcataaagcctggcatgagcagggcttcagcgtgctgggt
ttcccctgcaaccagtttctggagcaggagccaggcagtagcgaagaaatcaaaacgttt
tgcagcacgacctacggtgtgacgtttccgatgttcgaaaagtgtgaggtcaatggtgag
catcgtcatccgctttatgcacagctggtcgcggcgaaacccgaggccgtgcgtccggaa
gagagtggtttttatgagcgcatggtcagcaaaggacgggctcccaaagcgccgggcgat
attctgtggaacttcgaaaaattcctgatagggcgtgatggcagcgttattcagcgtttc
tcaccggacatgtcgccagaagatcccattattctggaaacgatcaaacaggcgctggca
aagtaa

DBGET integrated database retrieval system