KEGG   Pantoea ananatis LMG 5342: PANA5342_2585Help
Entry
PANA5342_2585     CDS       T01728                                 

Definition
Asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PANA5342_2585
Enzymes [BR:plf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PANA5342_2585
Peptidases [BR:plf01002]
 Cysteine Peptidases
  Family C44
   PANA5342_2585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2698857..2700575
Genome map
AA seq 572 aa AA seqDB search
MRVGKCNKKMESMDDEISYCESNIFKIAYSKTINETVSFSEDKESAFLGYITENDFIHLR
STLNIKKEPVSKCEVLKEMVRKYGYQSLSVLSGSFCFIDYNSNTKTVSVIRDRIGLVTLF
ACKAGNGWIFSTRIKFLLELSFLSYNLNRNTIQHYQYCGWSPRGASFLESIMNCEPGAIT
TFCYNNYSTILLNLPEKKAIPDDLLNAASTIKKNLEIAISHHIPSNKRIGIAVSGGIDSV
YMTSLVKKTIGERPLLTFSYGYDEYDPNIVGGKQISEFLNCEHTSVITYPHEIPQLLIDS
IAHLEEPVGRDQYLMLTKMAKVARGKVDTLITGNCGDAVFGSPPLAKYLLKASKWPFLRS
FYQDIATEDYSGALPESVAGKLYLKFLKKVKTPAAAKIIGSLGVENRIILPNQTPPLLKM
LEHDLQYAPGEQGIKSNLLYDMAKLELRQPYADISLLKMGLSIPDQWRFDGKTYKIALRM
SAKNDIPENLIWAPKGVARLKHDDRLWEIISDLIHNKITPEKIKSRGIYEKESLDKLLKI
PNRNKRTMRWLYRLWYIIALEIWCEIFIDHKK
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagtgggtaaatgtaacaaaaaaatggaatcaatggatgatgaaatctcttattgt
gaaagtaatatcttcaaaatagcttattcaaaaaccattaatgaaacagtaagtttctct
gaagataaagaatcagcatttctaggttatattactgagaatgattttattcatcttagg
agcacactaaatataaaaaaagaaccagtatcaaaatgcgaagttttaaaagaaatggta
cggaaatatggatatcaatcactctcagttttaagtggtagtttctgttttattgattat
aatagtaatacaaaaactgtatcagtgattagagatagaataggattagtaactttattt
gcttgtaaagcaggaaatggttggatattttccacgcgaataaaatttttattagaatta
agttttttaagttacaatttaaatagaaatacaatacaacattatcaatactgtggttgg
tcaccaagaggtgcatctttcctagaatcaataatgaactgcgagcctggagctataaca
actttttgttataataattattccactatattgttgaatcttccagaaaagaaagcaatt
cctgatgacttattaaacgcagcttctacaattaaaaaaaatctagaaatagccattagt
catcatataccttcaaacaaaagaataggaatagctgttagtggaggcatagactctgtt
tatatgacgtctctcgtcaaaaaaacaataggtgaaagacctttattaacgtttagttat
ggctacgatgagtatgacccaaatattgttggtggtaaacagatttcagaatttcttaat
tgcgaacatacttcggtaattacttatcctcatgaaattcctcagttactaattgattct
atagcgcatcttgaggaacctgtaggcagagatcagtatcttatgctaactaaaatggca
aaagttgcgcgaggaaaagttgatactttgattactggaaactgtggtgatgcagttttt
ggtagcccaccgttggctaaatatttacttaaagcttcaaaatggccatttttaaggtct
ttttaccaagatattgcgactgaagattactctggcgcacttcccgaatctgtggcagga
aagctgtacttaaaatttctaaaaaaagtaaaaactcccgctgcggctaaaatcattgga
tctttaggtgtagaaaatagaattattttaccaaatcaaacccctccacttttaaaaatg
cttgagcatgatttacaatatgcaccaggagaacaaggtattaaaagtaatctcctttat
gatatggcgaaattagagttacgacaaccatacgcagatataagtttattaaagatggga
ttaagcattccagatcaatggcgttttgacggcaaaacttataaaattgctttaagaatg
tctgcaaaaaatgatatacctgagaacttaatatgggccccaaaaggagttgcacgcctc
aaacacgatgataggttatgggaaataatctcagatttaattcataataaaatcacacca
gaaaaaatcaagagcagaggaatttatgaaaaagaaagtttagataaactactaaaaatc
cctaatagaaacaaaagaacaatgcggtggttatatcgtttatggtatattatagcttta
gaaatttggtgtgaaatattcatcgatcataagaaataa

DBGET integrated database retrieval system