KEGG   Pantoea ananatis LMG 5342: PANA5342_2607Help
Entry
PANA5342_2607     CDS       T01728                                 

Gene name
gpo2
Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PANA5342_2607 (gpo2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PANA5342_2607 (gpo2)
Enzymes [BR:plf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PANA5342_2607 (gpo2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2728433..2728915
Genome map
AA seq 160 aa AA seqDB search
MTTFHQLNATSLNGQHISMADYAGKLVLVVNTASHCGFTPQYTGLEALYKKYAAQGLVVL
GFPCNQFGKQEPGSADDIAQTCHIHYGVSFPMFEKVEVNGPGTHPLFRYLKAELPGVLGG
RIKWNFTKFLIGRDGKPLKRFAPIATPEKMEATLLAALES
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttttcatcaactcaacgccaccagcctgaatggccaacacatctcgatggcc
gactatgccggcaagctggttctggtggtgaacaccgccagccattgtggattcacacca
caatatacaggtcttgaagcactctacaaaaagtacgctgcgcaggggctggtggtgctg
ggtttcccttgcaaccagttcggtaagcaggaaccgggcagtgccgacgacatcgcgcag
acctgtcacattcactacggtgtgagcttccccatgttcgaaaaagtagaggttaacggc
cccggaacgcatccgctattccgttacctgaaagcggaattacccggtgtgctgggtggg
cggattaaatggaacttcactaagtttttgatcggacgcgacggcaaaccactcaagcgt
tttgcacccatcgctacgccggaaaaaatggaagccaccctcctggcggcactagaaagc
taa

DBGET integrated database retrieval system