KEGG   Pantoea ananatis LMG 5342: PANA5342_3087Help
Entry
PANA5342_3087     CDS       T01728                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase GalM
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00010  Glycolysis / Gluconeogenesis
plf00052  Galactose metabolism
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01120  Microbial metabolism in diverse environments
plf01130  Biosynthesis of antibiotics
Module
plf_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA5342_3087 (galM)
   00052 Galactose metabolism
    PANA5342_3087 (galM)
Enzymes [BR:plf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PANA5342_3087 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CCF10480
Position
3226323..3227357
Genome map
AA seq 344 aa AA seqDB search
MLNDVNSHAPDGQPWRITVLRNANGMIATFMDWGATWLSARVPLQDGHVREALLGCATPS
DYLHQDAYLGATVGRYANRIAGAKLNKISRPLSANQGEHQLHGGPEGFDKRRWQIVSQSE
TEVHYRLDSPDGDQGYPGNLIADLRYVLDDDNCLSIHYQAQCDQPCPVGLTNHAYFNLDA
HHGDARQHRLQLHADRYLPVDSEGIPNGPLKAVDGTSFDFRQAKRIEQDFLADDDQKAVK
GYDHAFLLNSAGDSSQPAAELWSEDGKLQLSVTTSAPALQFYSGNYLAGTRAREQESYTA
FQGIALESEFLPDSPNHPEWPQDDCWLQPGDRWESVTRYRFTPR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacgatgtgaactcccatgcgccggacggtcagccgtggcgcatcaccgtatta
cgtaatgccaatggcatgattgccacctttatggactggggcgcaacctggctgtcggcg
cgggtcccactgcaggacggtcacgtgcgtgaagccctgctgggctgtgcaaccccttcc
gactatctgcatcaggatgcctatctgggtgccacggtaggccgttatgcgaaccgtatt
gccggcgcgaaactgaataaaatcagccgcccgttgagcgccaatcagggcgaacatcag
ttacacggcggcccagaagggtttgataaacgccgctggcaaattgtcagtcagtcagaa
acggaagtacattatcgtcttgattcgcccgatggcgatcagggctacccgggcaacctt
attgctgatttacgctatgtgctggatgacgataactgcctgtccattcactatcaggcg
cagtgcgaccagccctgcccggtcggtctcaccaaccatgcttactttaatcttgatgcg
catcatggtgatgcgcgccagcatcggttacaactgcacgccgatcgttacctgcccgtg
gatagcgaggggattcccaacggcccactgaaggccgtggacggcaccagcttcgatttc
cgtcaggccaaacgcattgagcaggattttcttgccgatgacgatcagaaggcagttaaa
ggctatgaccatgctttcctgctgaacagtgcaggcgatagcagccagcctgccgctgaa
ctctggtcagaggacggcaagctccagttgagcgtgaccacgtcagcgcccgcgttacag
ttctacagcggtaactatctggccggcacgcgcgcccgggagcaggaaagctatactgct
tttcaggggatcgcgctggagagtgaatttttaccggattcgcctaatcatcccgagtgg
ccacaggatgattgctggctgcaaccgggagatcgttgggaatccgtcacgcgctatcgc
tttacaccacgctga

DBGET integrated database retrieval system