KEGG   Pantoea ananatis LMG 5342: PANA5342_3088Help
Entry
PANA5342_3088     CDS       T01728                                 

Gene name
gpmA1
Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PANA5342_3088 (gpmA1)
   01230 Biosynthesis of amino acids
    PANA5342_3088 (gpmA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA5342_3088 (gpmA1)
  Energy metabolism
   00680 Methane metabolism
    PANA5342_3088 (gpmA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA5342_3088 (gpmA1)
Enzymes [BR:plf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PANA5342_3088 (gpmA1)
Exosome [BR:plf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PANA5342_3088 (gpmA1)
  Exosomal proteins of melanoma cells
   PANA5342_3088 (gpmA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3227507..3228259
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSDKGRTEAKAAGQLLKKEGFVFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWRLNERHYGALQGLDKAETAAKYGDEQVKQWRRGFA
VTPPELDRSDERFPGHDPRYASLKPEQLPTTESLALTIERVIPYWNESILPRIKSGEKVI
VAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIKHYYLGDADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgacacggcgaaagccagtggaacaacgaaaac
cgcttcaccggatggtatgatgtagacctttctgacaagggccgtaccgaagctaaagca
gccggacagctgctgaagaaagaaggtttcgtgtttgatttcgcctacacctctgtgctg
aaacgcgccattcacaccctgtggaatgtgctggatgagctggatcaggcctggctgccc
gttgagaaatcctggcgtctgaacgaacgtcactatggcgcgctgcagggcctggacaaa
gctgaaaccgccgcaaaatacggcgacgagcaggttaaacagtggcgtcgtggcttcgcg
gtgactccgccagagttggaccgcagcgatgagcgttttcctggacacgacccgcgttat
gcttcactgaagcctgagcagctgcccaccaccgaaagcctggcgctgaccatcgaacgc
gtgatcccttactggaacgaatccattctgccacgtatcaaaagtggtgagaaagtgatc
gtggcggcccacggtaactcactgcgtgcgctggtgaaatacctggacaacatgagcgaa
gaagagattcttgaactgaatatcccgaccggcgttccgctggtgtacgagttcgatgaa
aacttcaaaccgatcaaacattactacctgggtgatgctgacgagatcgcagcgaaagcc
gcggccgttgccaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system