KEGG   Pantoea ananatis LMG 5342: PANA5342_3112Help
Entry
PANA5342_3112     CDS       T01728                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00020  Citrate cycle (TCA cycle)
plf00640  Propanoate metabolism
plf00660  C5-Branched dibasic acid metabolism
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01120  Microbial metabolism in diverse environments
plf01130  Biosynthesis of antibiotics
plf01200  Carbon metabolism
Module
plf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PANA5342_3112 (sucC)
   00640 Propanoate metabolism
    PANA5342_3112 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PANA5342_3112 (sucC)
Enzymes [BR:plf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PANA5342_3112 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CCF10505
Position
complement(3252053..3253219)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIDQELYLGAVVDRATRR
VIFMASTEGGVEIEKVAEETPHLIHKMALDPLTGPQPYQGRELAFKLGLTGKQVSQFTKI
FMGLATMFLERDLAMVEINPLVITKQGDLICLDGKLGADGNALFRQPELREMRDPSQEDP
REAHATQWELNYVALEGNIGCMVNGAGLAMGTMDIVKHHGGQPANFLDVGGGATKERVTE
AFKIILSDDAVKAVFVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQRVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaataccaggctaaacagctgtttgcacggtatggcatgccagcaccg
accggctacgcctgtactacaccacgtgaagcagaagaagcggcatcgaaaatcggtgca
ggcccgtgggtagttaaatgtcaggttcatgccggtggccgcggtaaagcgggcggtgtg
aaagtggttaacagcaaagaagacatccgtgctttcgctgaaaactggctgggcaaacgt
ctggtgacctaccaaactgacgccaatggccagccggtaaaccagattctggttgaagcg
gcaaccgatatcgatcaggagctgtacctgggtgccgtggttgaccgtgcaacccgtcgc
gtcatctttatggcatcgaccgaaggcggcgtggaaatcgagaaagtggcagaagaaacg
ccacacctgatccacaaaatggcgcttgatccactgaccggtccacagccttatcagggc
cgtgagttagcctttaaactgggcctgaccggtaagcaagtcagccagttcaccaaaatt
ttcatgggtctggccaccatgttcctggagcgcgatctggcgatggttgagatcaacccg
ctggtgatcaccaagcagggcgacctgatctgtctggatggcaaactgggtgccgatggc
aatgccctgttccgtcagccagagctgcgtgaaatgcgcgatccaagccaggaagatcct
cgtgaagcgcacgcgacacagtgggaactgaactatgttgcgctggaaggcaacatcggt
tgtatggttaacggcgcaggcctcgcgatgggtacgatggacatcgttaagcaccacggt
ggccagccagcgaacttcctggatgttggcggcggcgcgaccaaagagcgcgtaaccgaa
gcctttaaaatcatcctgtctgacgacgcggtgaaagcggtattcgttaacatcttcggc
ggcatcgtgcgttgcgacctgatcgcagacggcatcatcggtgcagtagcagaagtcggt
gttaacgtaccggtcgtggtacgtctggaaggtaacaacgctgaactgggcgctaagaaa
ctggcggacagtggtctgaacatcattgcagcaaccagtctgacagacgcggcacagcgt
gttgttgctgctgcggagggtaaataa

DBGET integrated database retrieval system