KEGG   Pantoea ananatis LMG 5342: PANA5342_3113Help
Entry
PANA5342_3113     CDS       T01728                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase (dihydrolipoyltranssuccinase E2 component)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PANA5342_3113 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PANA5342_3113 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PANA5342_3113 (sucB)
Enzymes [BR:plf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PANA5342_3113 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3253288..3254511)
Genome map
AA seq 407 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVSRDEVIVEIETDKVVLEVPASADGVLEAV
LEDEGATVTSRQILGRLKEGNSAGKESSAKAESNDTTPAQRQTASLEEESSDALSPAIRR
LIAEHNLDAAQIKGTGVGGRLTREDVEKHLANKPQAEKAAAPAAGAATAQQPVANRSEKR
VPMTRLRKRVAERLLEAKNSTAMLTTFNEINMKPIMDLRKQYGDAFEKRHGVRLGFMSFY
IKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLRDVDALSMADIEKK
IKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAV
NGQVVILPMMYLALSYDHRLIDGRESVGYLVAVKEMLEDPARLLLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctcgttcccgacctgcctgaatcggttgcagatgccacagta
gcaacctggcacaagaaaccaggcgatgcagtcagccgcgatgaagtcatcgtcgaaatt
gaaactgacaaagtcgtgctggaagtgccggcatctgccgatggcgtgctggaagccgtg
ctggaagacgaaggggcaaccgttacgtcccgccagatcctgggtcgcctgaaagaaggc
aacagtgcgggtaaagaaagcagtgccaaagcggaaagcaatgacaccacgccagcccag
cgtcagacagcgtcgcttgaagaagagagcagcgatgcgctcagcccggcgatccgtcgc
ctgattgcggagcataatcttgacgctgcgcagatcaaaggcaccggcgtgggcggacgt
ttaacacgtgaagacgttgaaaaacatctggcgaacaaaccgcaggctgagaaagccgcc
gcgccagcggcgggtgcagcaacggctcagcagcctgttgccaaccgcagcgaaaaacgt
gttccgatgacgcgtttacgtaagcgcgtcgcggagcgtctgctggaagccaagaacagc
accgccatgttgacgaccttcaacgaaatcaacatgaagccgattatggatctgcgtaag
cagtacggcgatgcgttcgagaaacgtcatggtgtgcgtctgggctttatgtctttctac
atcaaggccgtggtcgaagcgctgaagcgttatccagaagtcaacgcctctatcgatggc
gaagacgtggtgtaccacaactatttcgatgtgagtattgccgtctctacgccacgcgga
ctggtgacgcctgtcctgcgtgacgttgatgcgctgagcatggctgacatcgagaagaaa
attaaagaactggcagtgaaaggccgtgacggcaagctgacggttgacgatctgacgggc
ggtaactttaccatcaccaacggtggtgtgttcggttcgctgatgtctacgccaatcatc
aacccgccacagagcgcgattctgggcatgcacgccattaaagatcgtcctatggcggtc
aatggtcaggttgtgatcctgccaatgatgtacctggctctctcctacgatcaccgttta
atcgatggtcgtgaatctgtcggctatctggtcgcggtgaaagagatgctggaagatccg
gcgcgtctgctgctggatgtctga

DBGET integrated database retrieval system