KEGG   Pantoea ananatis LMG 5342: PANA5342_3117Help
Entry
PANA5342_3117     CDS       T01728                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00020  Citrate cycle (TCA cycle)
plf00190  Oxidative phosphorylation
plf00650  Butanoate metabolism
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01120  Microbial metabolism in diverse environments
plf01130  Biosynthesis of antibiotics
plf01200  Carbon metabolism
Module
plf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
plf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PANA5342_3117 (sdhD)
   00650 Butanoate metabolism
    PANA5342_3117 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PANA5342_3117 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: CCF10510
Position
complement(3260033..3260380)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIQDWLLLRATAILITLYIIYLLGFVVMTDTLTYDIWRGFFASAFTKVF
TLLTLFSILIHGWIGMWQVLTDYVKPLATRLLLQLVIVVALLSYAIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcatccgcgttgggtcgcaatggcattcaggactggctgctgctgcgc
gcgacggcaatcctcatcacgctttacatcatctatctcctcggtttcgtagtgatgaca
gacacgctgacgtatgacatctggcgtggcttcttcgcttctgcatttacaaaagtgttc
acgctcctgacgctgttttccattctgatccacggctggatcggtatgtggcaggtctta
acggactacgttaaaccgctggcaacgcgtctgctgttgcagttggtcatcgtagtggcg
ctgttgtcatatgcaatttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system