KEGG   Pantoea ananatis LMG 5342: PANA5342_3146Help
Entry
PANA5342_3146     CDS       T01728                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:plf00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3288018..3289685
Genome map
AA seq 555 aa AA seqDB search
MCSIFGVLDLKSDPVELRKKALESSRLMRHRGPDWSGVYADDHAILAHERLSIVDVNNGA
QPLYNADHTHVLAVNGEIYNHQALRAKLSDRYAFQTGSDCEVILALYQEKGVDFLDELEG
MFAFILYDSVKGTYLIGRDHIGIIPLYMGNDEHGNLFVASEMKALVPVCRSIKEFPPGSY
LSSTDGEIRRYWQRDWMEYQNVENNVTDAAELKHALEESVKSHLMSDVPYGVLLSGGLDS
SIISAVTKRFAAKRVEDQDKSDAWWPQLHSFAVGLEGSPDLKAAKLVAEHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGADEVFGGYLY
FHKAPNAKEFHEENVRKLLALHMFDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGSNGKMEKHILRECFSSYLPESVAWRQKEQFSDGVGYSWIDTLKEVAAKQISDQQLA
TAHFRFPYNTPGSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKNMD
DPSGRAVGVHQSAYK
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctatttttggtgtgctggatctgaaaagcgatcccgttgagttacgtaaaaaa
gcattggaaagctcacgtttgatgcgtcaccgtgggccggactggtcaggcgtttacgcc
gatgaccacgccattcttgctcatgagcgcctctcaattgttgacgtgaacaacggtgca
cagccgctgtataacgctgaccacacccacgtactggcagtcaatggtgagatctacaac
catcaggccctgcgcgcaaaattgagcgatcgctacgcgtttcagaccggttctgactgc
gaagtgattctggcgctgtaccaggagaaaggtgtcgattttcttgacgaactggaaggc
atgtttgccttcatcctgtatgacagcgtcaaaggcacctatctgattggccgtgaccat
atcggtatcatcccgctgtatatgggcaacgatgagcacggtaacctgtttgtcgcctca
gaaatgaaagcgctggtgccggtgtgccgttcaatcaaagaattccccccaggaagctac
ctttccagcaccgacggtgaaattcgtcgttactggcagcgtgactggatggaataccag
aacgttgagaacaacgtgaccgacgcagcagaactgaaacatgcgctggaagagtcagta
aaaagccacctgatgtccgatgttccgtatggcgtgctgctgtctggtggtctggactcg
tcaattatttcagccgtaaccaaacgtttcgcggccaaacgcgtggaagatcaggataaa
agtgacgcctggtggccacagctgcactcgttcgcggtcggtctggaaggatcaccggat
ctgaaagcggccaaactggtggcagagcatctgggtacggtgcaccacgaaattcacttc
acggtgcaggaaggcctggatgcgattcgtgacgtgatctaccacattgaaacctatgat
gtgaccacgattcgcgcctccacaccgatgtacctgatgtcgcgtaagattaaagccatg
ggcatcaaaatggtgctgtcgggcgaaggggctgacgaagtctttggtggttatctgtat
ttccataaggcgccaaacgcgaaagagttccatgaggagaacgttcgcaaactgctggcc
ctgcacatgtttgactgcgcacgcgccaacaaagcgatgtctgcctggggcgttgaagca
cgcgtgccgttcctggataagaaattcctggatgtcgccatgcgtattaacccacaagac
aagatgtgcggcagcaacggtaaaatggaaaaacacattctgcgtgaatgcttctcctct
tacctgcccgaaagcgtggcctggcgccagaaagagcagttctctgacggcgtgggttac
agctggattgacacactgaaagaagtcgcggccaaacaaatcagcgatcagcaactggcg
acggcgcacttccgtttcccgtataacacgccggggtcgaaagaagcgtacctgtaccgt
gaaatctttgaagaactcttcccactgccgagcgctgcagagtgcgtaccaggcgggccg
tctgttgcctgttcatcggcaaaagccatcgagtgggatgaagcctttaaaaacatggat
gacccgtcaggacgtgccgtgggtgttcaccagtctgcctataaataa

DBGET integrated database retrieval system