KEGG   Pantoea ananatis LMG 5342: PANA5342_3248Help
Entry
PANA5342_3248     CDS       T01728                                 

Gene name
tesA
Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PANA5342_3248 (tesA)
Enzymes [BR:plf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PANA5342_3248 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PANA5342_3248 (tesA)
Lipid biosynthesis proteins [BR:plf01004]
 Fatty acid synthase
  Component type
   PANA5342_3248 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3397035..3397688
Genome map
AA seq 217 aa AA seqDB search
MLSLTHGLSKMMNFKNVFRWHYPFLLLCCLLVSRLAAADTLLVLGDSLSAGYQMSASKAW
PSLLDKNWQQQPRVINASISGDTAAQGLARLPALLKQHQPQWVLIELGGNDGLRGFPPKD
IEQTLSTIIEQVKTARAKPILMQVRLPANYGRRYTDAFRAIYPQLAKQHDIPLLPFFMEQ
VYLKPEWMQQDGIHPNPDAQPFIAELMAKELAPLVKQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctctccctgacccacggacttagtaagatgatgaacttcaagaatgttttccgctgg
cattatcctttcctgttattgtgctgtctgttggtgtcccgtcttgctgcggccgatacg
ttgctggtgctgggcgacagcctgagtgcaggctatcaaatgtcggccagtaaagcctgg
cccagcctgctcgataaaaactggcagcagcagcccagagtgattaatgccagtattagc
ggcgataccgccgcacaaggactggcacgcttacctgccctattaaaacagcaccaaccg
cagtgggtgttaatcgaattgggcggtaacgacggcttacgtggctttccgccaaaggat
attgagcaaacgttaagcaccatcatcgagcaggtaaaaaccgccagggctaaaccgatc
ctgatgcaggtacgtttacccgccaactacggccgccgttatacggatgcgttccgcgcg
atttatccgcagttggcgaaacagcacgatattcctttactgccctttttcatggagcaa
gtttatttaaaacccgaatggatgcagcaggatggtattcatcccaatcctgacgcccaa
ccctttatcgctgaactgatggcgaaagaactggccccattagttaagcagtag

DBGET integrated database retrieval system