KEGG   Pantoea ananatis LMG 5342: PANA5342_3267Help
Entry
PANA5342_3267     CDS       T01728                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:plf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PANA5342_3267 (recR)
DNA repair and recombination proteins [BR:plf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PANA5342_3267 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3416677..3417282)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMESLRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEICTICANPRRQQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
ADIGLDRLEQRLEKETLHEVILATNPTVEGEATANYIAELCGQYGVDASRIAHGVPMGGE
LEMVDGTTLSHSLAGRQKIKF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagccccctgctagagtctttaatggagtcgctgcgctgtttgccgggcgtt
gggcctaaatcggcccagcgtatggcgtttcaactgctacagcgcgatcggagtggcgga
atgcggctggcgcaggccctgacccgggcgatgtcggaaatcggccactgtgccgattgc
cgcaccttcaccgagcaggaaatttgcaccatttgcgccaatccccggcgtcagcaaaat
ggtcaaatctgcgtggttgagagcccggcagacatccatgctattgagcaaaccgggcaa
tttgccggccgctatttcgtgttgatggggcatctttcgccgctggacggcattggtcca
gccgatattggtcttgaccgactggaacaacggctggaaaaagaaacgcttcacgaagtg
attctggcgaccaatcccacggttgaaggtgaagctaccgcgaactacatcgctgaattg
tgcggacagtacggcgtcgacgcgagccgtattgcgcatggggttccgatgggcggtgaa
ctggaaatggtcgatggcaccacgctgtcccactccctcgccggtcgtcaaaagattaaa
ttttaa

DBGET integrated database retrieval system