KEGG   Pantoea ananatis LMG 5342: PANA5342_3540Help
Entry
PANA5342_3540     CDS       T01728                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PANA5342_3540 (folK)
Enzymes [BR:plf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PANA5342_3540 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3702217..3702702
Genome map
AA seq 161 aa AA seqDB search
MTRVYLALGSNLADPLHQIDAALSALDALPETQRVATSPFYRTPPYGPPDQPDYLNAAVA
LETTLTAEALLDQTQRIEREHGRVRKAERWGPRTLDIDIMLFGTDSLNSDRLIVPHYDLL
NRAFMLVPLLAIAPNLHLPDGRPLQPLLARFDCSSIRPWHS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggtttatctggcattaggcagtaaccttgccgatccgctgcatcagattgat
gcagcgctctcagccctggacgctctccctgagactcaacgcgtagctacctcccccttt
taccgcacgccgccctatggcccacccgaccagccggactacctcaatgcggcggtagcg
cttgaaaccacgctcactgccgaggcgctcctggatcaaacccagcgaattgaacgggaa
catggccgcgttcgcaaagccgagcgctggggcccgcgcacgctggatattgatatcatg
ctgtttggtacagacagcctcaacagcgatcggctgatcgtgccgcattacgacctgctt
aatcgcgcatttatgctggtaccgctgctggcgattgcgcccaatctgcacctgcctgat
ggccgcccgcttcagccgcttctggccagatttgactgctccagcatccgtccctggcac
agctga

DBGET integrated database retrieval system