KEGG   Pantoea ananatis LMG 5342: PANA5342_3566Help
Entry
PANA5342_3566     CDS       T01728                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase (dihydrolipoyltransacetylase component)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00010  Glycolysis / Gluconeogenesis
plf00020  Citrate cycle (TCA cycle)
plf00620  Pyruvate metabolism
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01120  Microbial metabolism in diverse environments
plf01130  Biosynthesis of antibiotics
plf01200  Carbon metabolism
Module
plf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA5342_3566 (aceF)
   00020 Citrate cycle (TCA cycle)
    PANA5342_3566 (aceF)
   00620 Pyruvate metabolism
    PANA5342_3566 (aceF)
Enzymes [BR:plf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PANA5342_3566 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H HlyD_D23 NQRA DUF1223
Motif
Other DBs
NCBI-ProteinID: CCF10959
Position
complement(3728405..3730294)
Genome map
AA seq 629 aa AA seqDB search
MAIEIKVPDIGSDEVEVTEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
TGDKVETGSLIMMFDAEAAAEAAPAPAHEKKAEAAPAAAPASASKDVNVPDIGGDEVEVT
EILVKVGDKVEAEQSLIVVEGDKASMEVPAPFAGVVKAIKISTGDKVNTGSHIMVFEAEG
AAPAADAKPDVKEDAAPAPAAAAGSKEVNVPDIGGDEVEVTEVLVKVGDKVEAEQSLIVV
EGDKASMEVPAPFAGTVKELKVATGDKVSTGSLIMVFEVEGAAPAAAPAAKKEAAPAPAA
SESKPAAPAAKAESKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILKEDVQ
AYVKDAVKRAEAAPAAASGGGLPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWV
MIPHVTHFDKTDITELEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFNSSL
SEDAQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGITELSRELMAISKKARDGKLTAG
DMQGGCFTISSLGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFAPRLMMPISLSF
DHRVIDGADGARFITIIGNMLSDIRRLVM
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaatcaaggtaccagatatcgggtcagacgaagttgaagtcaccgaaatt
ctggtcaaggttggcgacaaggtggaagccgagcagtcgctgatcaccgtggaaggcgat
aaagcctctatggaagttccctcgccgcaggctggcgtggtgaaagagatcaaaatcgca
accggtgacaaagtggaaaccggttcgctgatcatgatgtttgacgcagaagccgctgca
gaagcagcccctgcgcccgcgcatgagaaaaaagcagaggccgcgccagccgctgcacct
gccagcgccagcaaagacgttaacgtgccggacatcggcggtgatgaagttgaagtcacc
gagattctggtgaaagtgggcgacaaagttgaggctgagcagtcacttattgtcgttgaa
ggtgacaaagcctcaatggaagttcctgcgccgttcgcgggcgtggtgaaagcgatcaaa
atctcgaccggcgataaagtgaataccggttctcacatcatggtctttgaagcagaaggc
gctgcgcctgctgcagatgcgaagccagacgtgaaagaagacgcggcgccggcacctgcc
gctgccgcgggttcaaaagaggtcaacgtacctgacatcggcggtgacgaagtcgaagtc
accgaagtgctggtgaaggtgggtgataaagtcgaagctgagcagtcactgattgtggtg
gaaggcgataaagcgtcgatggaagtcccggcacctttcgcgggcacggtcaaagaactg
aaagtggcaacgggcgataaagtcagcaccggttcgctgatcatggtgtttgaagtggaa
ggcgctgcgcctgccgctgcaccggctgccaaaaaagaggcggcacctgcgccagcggcg
tcggaatcgaagcctgctgcacctgctgctaaagcagagagcaaaggcgaatttgccgaa
aacgatgcgtatgtgcatgccacgccggtcattcgtcgcctggcgcgtgaatttggcgtt
aaccttgccaaagttaaaggcacaggccgtaaaggtcgtattctgaaagaagacgttcag
gcttacgttaaagatgccgtgaaacgcgcagaagccgcgccagccgccgccagcggtggc
ggcctgccgggcatgctgccatggccgaaggttgacttcagtaagtttggtgaagttgaa
gaagtggagctgggccgtatccagaaaatctcgggtgcgaacctgagccgtaattgggtc
atgatcccacacgttacgcacttcgacaaaaccgatattaccgagcttgaagctttccgt
aagcagcagaacgccgaagcggagaagcgtaagctggacgtgaaatacacgccagtggtc
ttcatcatgaaagcggtggcggcggcgcttgagcagatgccacgctttaacagctcactg
tctgaagatgcgcagaagctgacgctgaaaaagtacatcaacatcggtgtggcggtggat
acgccaaatggcctggtggttccggtctttaaagacgtgaacaagaagggcattacagaa
ctgtctcgtgaactgatggcgatctctaaaaaggcgcgcgatggcaaactaaccgcaggc
gacatgcagggcggctgtttcaccatctccagccttggcggcctgggcaccacccacttt
gcgccgattgttaacgcgccagaagtggccatccttggtgtgtcaaagtcagcgatggag
ccagtgtggaacggtaaagagtttgcaccacgtctgatgatgccaatctctctgtccttc
gatcaccgcgttatcgacggtgcagatggcgcacgtttcattaccattattggcaatatg
ctgtcagacattcgtcgtctggttatgtaa

DBGET integrated database retrieval system