KEGG   Pantoea ananatis LMG 5342: PANA5342_3657Help
Entry
PANA5342_3657     CDS       T01728                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase ThrC
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PANA5342_3657 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA5342_3657 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PANA5342_3657 (thrC)
Enzymes [BR:plf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PANA5342_3657 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3835712..3836995)
Genome map
AA seq 427 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVKQGLGSQQGLFFPLELPEFELTDIDAMLEMDFVTRSSKILS
AYIGDEIPAAHLTERLKTAFTFPAPVKAVSDDIACLELFHGPTLAFKDFGGRFMAQMLSY
VSGSDEQITILTATSGDTGAAVAHAFYGMENVRVVILYPQGKISPLQEKLFCTLGGNIET
IAIDGDFDACQSLVKQAFDDQALKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEKRN
QLVVSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLGKGEWQPNATVATLSN
AMDVSQPNNWPRVEELFRRKTWRLSDLAYGAVTDDVTREAMRELAKLGYVSEPHAAIAWR
LLRDQLQEGEFGLFLGTAHPAKFLESVESILDQKLALPAELAERADLPLLSHQMGADFAQ
LRAFLLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaaccttaaggatcataacgagcaggtcagcttcgcccaggcggtgaaa
caaggtctgggttcacagcaagggctgttttttccgctcgaactgccggaatttgaactg
accgacatcgatgccatgctggaaatggattttgttacccgcagcagtaaaatcctttca
gcctatatcggggatgaaatcccggcagcgcacctgactgaacgcctgaaaaccgcgttc
accttcccggcgccggttaaggccgtcagcgacgacattgcctgcctggagttgttccac
ggcccgacgctggcgttcaaagattttggcggccgcttcatggcgcagatgctgtcatac
gtcagcgggtcggatgagcaaattaccattctgacggcgacgtccggcgataccggtgct
gccgtggctcacgccttttacggtatggagaatgtgcgtgttgtcatcctctatccgcag
gggaaaatcagcccgttacaggagaagttgttctgtacgctgggcggcaacatcgaaacc
attgcgattgacggcgattttgacgcctgccagtcgctggttaagcaggcgtttgacgat
caggcgctgaaaaaggcgatcggcctgaactccgctaactcgattaacatcagccgcctg
ctggcgcagatttgctactactttgaagcggttgcccaactgccgcaggagaagcgtaat
caactggtggtctccgtgccaagcggaaactttggtgatttaacggccggcctgctggcg
aaatcactgggcctgccgattaaacgctttatcgccgcgaccaacgccaacgatacggtg
ccacgtttcctgggcaagggtgaatggcagcctaacgccaccgtggcgacgctgtcgaat
gctatggacgttagccagccaaacaactggccgcgtgtggaagagctgttccgccgtaaa
acctggcgtctgagcgatctggcttacggtgcggtaacggacgatgttacgcgtgaagcg
atgcgcgagctggcgaagctgggttacgtctctgagccgcatgcggcaattgcctggcgt
ctgttgcgtgaccagctgcaggaaggggagtttggtttattcctcggaacggcccatccg
gctaagttcctggagagcgtggaaagcattctggatcagaaactggcattgcctgccgag
ctggctgagcgcgcggatctgcccctgctgtcgcatcagatgggcgcagattttgcccaa
ctacgggcgtttctgctcaagtaa

DBGET integrated database retrieval system