KEGG   Pantoea ananatis LMG 5342: PANA5342_3683Help
Entry
PANA5342_3683     CDS       T01728                                 

Gene name
rbkS
Definition
(RefSeq) sugar kinase, ribokinase family
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PANA5342_3683 (rbkS)
Enzymes [BR:plf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PANA5342_3683 (rbkS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3871782..3872699)
Genome map
AA seq 305 aa AA seqDB search
MDIAVIGSNMVDLITYTNSFPKAGETLEAPDFAIGCGGKGANQAVAAAKLGGEVMLVSKV
GDDLFAPTTLANLQQQGVDTRYVTTEKGVSSGVAPIFVDDQSQNRILIIKGANQHLKPAD
IDAAGDALKRCRLIILQLEIPLETVYYAIDFARQHDIRVILNPAPAVADLDIRYACQCDF
FMPNETELEILTGMPVGTDDDVRLAGASLLKRGLKNLIVTLGSRGSLWMTGETQHQVAPV
PVKAVDTSGAGDAFIGCFAHELVKTGDIPAAMAKASAYAACSVTARGTQRSYPDTAEFQR
FLDLQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgccgttattggttcaaacatggtggatttaatcacctataccaacagcttt
cctaaagctggagagacgcttgaggcacccgattttgcgattggctgtgggggaaaaggg
gccaatcaggctgtggcggcagcaaaactgggtggcgaggtgatgctggtcagtaaagtc
ggcgatgacctgtttgcgcccaccacgttggctaatttgcaacagcagggcgtggatacg
cgttatgtcacaaccgaaaaaggggtttccagcggcgtggcccccatttttgttgatgat
cagtcgcaaaaccgcattttaattatcaaaggcgcgaatcagcacctcaagccggcggat
attgatgctgcgggtgatgcgttgaaacgctgtcggttgatcattcttcagctcgaaatt
ccgctggaaacggtgtactacgctatcgattttgcccgtcagcatgatattcgcgtcatc
ctcaaccctgcgcccgccgtggcagacctggatatccgctatgcctgccagtgcgacttt
tttatgcccaatgagacggagctggaaattcttaccgggatgccggtggggacggatgat
gacgtcaggctggccggtgcgtccttgctgaaacgtggcctgaaaaacctgatcgttacg
ctgggcagtcgcggatcgttgtggatgaccggagagacacagcaccaggttgcgcctgtg
ccggttaaggcagtggataccagcggtgccggtgatgcgtttatcggctgcttcgctcat
gaactggtgaaaacgggcgatattcctgcggcgatggccaaagcctccgcctacgcggcc
tgtagcgtgacggcgcgcggcacacaacgttcttatcctgatacagcggaatttcagcgc
tttcttgaccttcagtga

DBGET integrated database retrieval system