KEGG   Pantoea ananatis LMG 5342: PANA5342_3799Help
Entry
PANA5342_3799     CDS       T01728                                 

Gene name
argE5
Definition
acetylornithine deacetylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:plf01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:plf00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4009638..4010753
Genome map
AA seq 371 aa AA seqDB search
MALTRTADLALQLIRFDTLNPPGNEAACMMFFASWLEENGFEVTLSSFGEGRHNLIARLR
GEQAGPALAFTGHLDTVPLGNADWQHDSFGEIVDDRLYGRGSSDMKAAVAAFAVACVTHQ
QAIRQGPGVVLLITGGEETGCDGARALIDTADLPEVGALIVGEPTANYPVIGHKGALWLR
CETRGKTAHGAMPELGINAIYLAADALGKIQHFSPGAPHPLMKQPTINVGRITGGLNINS
VPDRTQFDVDIRSAPNLQHATIRQQLSTLLGESVTISTLVDLPAVLSEGDHAWIQAVYQR
CQPLHDVPLVPRIVPYFTDASLLLPALGNPPCIILGPGEPSMAHQTDEYCLLSRLAEAEA
LYGALIRDWGA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcccttacccgcacggcggatctggcgttacagctgatccgctttgataccctcaat
ccaccgggtaacgaagccgcctgcatgatgttttttgccagctggctggaggaaaacggc
ttcgaggtcacgctgtcatccttcggcgaaggacgccataacctgatagcccgcctgcgc
ggcgagcaggccggacctgcgctggcctttaccggccatctggatacggtgccgctcggt
aacgccgactggcagcacgattcctttggcgagatcgtggacgatcggctctatggccga
ggatcgagcgatatgaaagcggccgttgccgcctttgccgtggcctgcgttacgcaccag
caggccattcgccaggggccgggcgtggtgctgctgattaccggcggtgaggaaaccggc
tgcgacggcgcgcgggcgctgatcgataccgctgacctgcccgaggtgggcgcgctgatc
gttggcgaacccaccgcgaactatccggttatcggccacaaaggcgcactgtggctgcgc
tgtgaaacacgcggtaaaaccgcgcacggcgcgatgccggagctgggcatcaatgcgatc
tacctggccgccgatgcgctgggtaaaattcagcatttctcccccggcgcgccgcatccg
ctgatgaaacagcccacgatcaacgtcgggcgcatcacaggcggcctgaacattaactcc
gtgcctgaccgcacgcagtttgacgtggatattcgtagcgcgcccaatcttcagcacgcc
accatccgtcagcagctcagcaccttactgggcgaaagtgtgacgatatctacgctggtg
gacctgcccgcggtactcagtgaaggcgatcacgcatggattcaggcggtttatcaacga
tgccagccattgcatgatgtacccctggtgccgcggattgtgccctacttcaccgatgcg
tcgctgctgttgcctgcgctgggcaatccgccctgcattattctgggccctggcgagccg
tcgatggcgcatcagaccgatgaatattgcctgctgagcaggttagcggaagccgaggcg
ctgtatggcgcgttgatcagggactggggcgcgtaa

DBGET integrated database retrieval system