KEGG   Pantoea ananatis LMG 5342: PANA5342_4038Help
Entry
PANA5342_4038     CDS       T01728                                 

Definition
glycosyl hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
plf  Pantoea ananatis LMG 5342
Brite
Enzymes [BR:plf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     PANA5342_4038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4255142..4256377)
Genome map
AA seq 411 aa AA seqDB search
MQRIAADGEVVWRYKKAGAGPTWPEYCPLESGGIVALRLTDTVFTSTSPCRRRFLKSSAA
LMLAGALPLPVLASIPPFPALKTVAAQSHRLFGFAVRPDSLQSDAHYRQFVASQASIIVP
ENALKWMAVHPARDRYDFAGPDAIAAFAREQGIRLRGHTFCWHRALPDWVQAIADEAELE
KVLRQHIATVAGRYRGQIHSWDVANEIINLADGQPGGWRNSFWYQRLGTRYMDIACEALH
QADPHAVICYNDYGLESDDVSGQRKRAAVLAMLRDLQSRHIPIGALGIQSHLKAGPHPAF
GPGLAAFIHDVKSLGLKVYITELDVDDSSVPMESRPMAVAALYKRYLSLVLEAGVAAILT
WGVWDTPHRTAATPKAGDALATGPLLFGKDGSIKEASWAALHALRSSPDLR
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaatcgcggcagacggcgaggtcgtttggcgctataaaaaagcaggggccggg
ccaacgtggccggaatattgcccactggaatccggaggcatcgtggcgctacgtcttacc
gataccgtctttacctcaacctcgccatgccgacgccggtttctgaaaagcagcgcggcg
ctgatgctggcgggcgcgctgccgttgccagttctggcatccatcccaccttttcccgcc
cttaaaactgttgcggcgcaaagtcatcggctgtttggctttgccgtcaggcccgacagt
ctgcaatccgatgcgcactatcggcagtttgtggcgagtcaggcgagcattatcgtgccg
gaaaatgcgctgaaatggatggccgtccatcccgcgcgcgatcgctacgatttcgccggg
cccgatgcgatcgccgcctttgcccgcgagcaggggataaggcttcgcgggcatacgttt
tgctggcaccgcgccctgccggactgggtacaggctattgctgatgaggctgagctggag
aaggttttgaggcagcatatagcgaccgttgcgggccgctaccgcgggcagattcacagt
tgggacgtggctaacgaaatcatcaatctcgccgacggacaacctggtggatggcgcaac
agtttctggtatcagcggcttggtacgcgttatatggatattgcctgcgaggcgctgcac
caggccgatccccatgcggtcatctgttacaacgattacgggctggaaagtgacgatgtg
agtgggcaaaggaaacgggcggcggtactggctatgctgcgcgacttgcagtccagacat
attccgattggcgcgctcggcatccagtctcatctcaaagccggtccccatcccgctttt
gggccggggctggcggcatttattcacgacgtgaaatcgcttggcctgaaggtgtacatc
accgaactggacgtggatgacagcagcgtgccgatggagagccggccgatggcggttgcc
gcgctgtataaacgctatctttcactggttctggaggcgggcgttgccgccattttaacg
tggggcgtttgggatacgccgcaccgcacggctgcgacaccgaaggcgggggacgcgctg
gcgaccgggccgctgctgtttggtaaagacggcagcattaaagaggccagttgggcggcg
ctgcacgcgctccgctcatcaccggatctcagatga

DBGET integrated database retrieval system