KEGG   Pantoea ananatis LMG 5342: PANA5342_4123Help
Entry
PANA5342_4123     CDS       T01728                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00010  Glycolysis / Gluconeogenesis
plf00620  Pyruvate metabolism
plf00640  Propanoate metabolism
plf00680  Methane metabolism
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01120  Microbial metabolism in diverse environments
plf01130  Biosynthesis of antibiotics
plf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA5342_4123 (acs)
   00620 Pyruvate metabolism
    PANA5342_4123 (acs)
   00640 Propanoate metabolism
    PANA5342_4123 (acs)
  Energy metabolism
   00680 Methane metabolism
    PANA5342_4123 (acs)
Enzymes [BR:plf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PANA5342_4123 (acs)
Lipid biosynthesis proteins [BR:plf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PANA5342_4123 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CCF11516
Position
4351410..4353365
Genome map
AA seq 651 aa AA seqDB search
MSQHHIYPVPENIAANALITAEQYQAMYQQSVTDPETFWGEQGKILDWIKPYSKVKNTSF
APGNISIRWYEDGTLNLAANCLDRHLATRGDHPAIIWEGDDANESKTITFRQLHADVCRF
ANVLELLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRVIDSSA
ALIVTADEGVRAGRKIPLKKNVDEALKNPNVNSVKNVVVFQRTGKDVGWVEGRDRHWHEL
MQNASTNHSAAEMQAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKFVFDYHQDDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTSARMAQVVDKHKVTLLYTAPTA
IRALMAEGDKAIEGTDRSSLRIMGSVGEPINPEAWEWYHKKIGNSQCPIVDTWWQTETGG
FMITPLPGATRLKAGSATTPFFGVQPALVDNEGHPQEGACEGNLVITDSWPGQARTLFGD
HDRFEQTYFSTFKNAYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHSIKGQAIYAYITLNHGEEPSPELYTEVRNWVRKEIGPIATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQSITMP
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacatcatatctatcctgttccagaaaatattgcagcaaacgcgctgattact
gccgaacagtatcaggcgatgtaccagcaatcggttaccgatccagaaacattctggggg
gagcaaggtaaaatccttgactggataaagccttacagcaaagtcaaaaacacgtctttt
gcgcctggtaatatttccattcgttggtatgaggacggcacgctcaatctggcggcgaac
tgcctggatcgtcacctggcaacccggggcgatcatcctgccatcatctgggaaggtgat
gatgccaacgaaagcaaaacaataacctttcgtcagcttcacgccgatgtctgtcgcttt
gccaacgtgctggagctgctcggggttaaaaaaggcgatgtcgtcgcgatttatatgcca
atggtgccggaagccgcggtcgccatgctggcctgcgcgcgcattggcgccgtgcattcg
gttatttttggcggcttttcaccggaagcggtggcaggtcgcgtgatcgactccagtgca
gccttaattgtgacagccgatgaaggcgtgcgcgcggggcgtaagatcccactgaaaaaa
aatgtggatgaagcgttaaaaaatcccaacgtaaacagcgtgaaaaacgtcgtggtcttt
caacgtaccggcaaagacgtcggttgggttgaaggacgtgacaggcactggcacgagctg
atgcagaacgccagtaccaaccactctgcagcagaaatgcaggcagaagatccgctgttt
atcctgtatacctcaggttcaaccggcaagccgaaaggcgtgctgcatacgaccggcggc
tatctggtttacgccgcgaccacatttaagtttgtttttgactaccatcaggacgatatc
tactggtgtacggctgacgtaggctgggttaccggccacagctatctgctgtatggcccg
ctggcctgcggtgccacgacgctgatgtttgaaggcgtgcccaactggccgacgtccgcc
cgcatggcgcaggtggtggataagcataaagtcaccctgctctataccgcgcccacggct
atccgcgcgctgatggccgaaggggacaaggcgattgaaggcaccgaccgtagcagcctg
cgtattatgggttcggtcggggagccgattaatccggaagcctgggagtggtatcacaaa
aaaatcggcaacagccagtgtccaatagtggatacctggtggcagaccgaaaccgggggg
tttatgattaccccgctacccggcgcaacgcggcttaaggccggttctgcgaccacgcct
ttctttggcgtacagcccgcgctggtcgataatgaggggcatcctcaggaaggagcctgc
gaaggtaacctggttatcactgactcctggccaggccaggcccgaacgctgttcggcgat
cacgaccgtttcgaacaaacctatttctctaccttcaaaaatgcctactttagcggtgac
ggcgcgcgacgggatgaggacggttattactggattaccggccgcgtggatgatgtgctg
aatgtgtcaggacatcgtctgggcacggcagaaattgaatcggccctagtttcccaccct
aaaattgccgaagccgctgtggtggggatcccgcacagcattaagggccaggcgatttac
gcctatatcaccctgaatcacggcgaggagccctcaccagagctttataccgaagtgcgt
aactgggtacgcaaagaaattggcccgatcgccacgcccgatgtgctgcactggaccgac
tctctgcccaaaacccgctccggtaaaatcatgcgccgtatcctgcggaaaatcgccgcg
ggtgataccagtaatttaggcgatacgtcaacgctggccgatcctggcgtcgttgagaaa
ctgcttgaagagaaacagtccatcaccatgccgtaa

DBGET integrated database retrieval system