KEGG   Pantoea ananatis LMG 5342: PANA5342_4190Help
Entry
PANA5342_4190     CDS       T01728                                 

Gene name
aceA
Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:plf01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:plf00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4419731..4421032)
Genome map
AA seq 433 aa AA seqDB search
MTRTQHIQQLEKQWQDARWQGITRPYSAEEVINLRGSVVPACTLAERGAVKLWSLLNGDA
KKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANVAGQMYPDQSLYPVNSVPEVV
TRINQTFQRADQIQWANGTEPGDSRYIDYFLPIVADAEAGFGGVLNAFELMKSLISAGAA
AVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTILLARTDADAADLI
TSDCDEYDRPFIRGDRTAEGFFRTNAGIEQAISRGLAYAPYADVLWCETSTPDLVMAQRF
ADAIHARYPGKLLAYNCSPSFNWKKNLDDKTIAAFQQALSDMGYRFQFITLAGIHSMWFN
MFDLAHAYAQGEGMRHYVEKVQQPEFAARERGYSFSSHQQEVGTGYFDQVTNTIQGGKSS
VTALTGSTEEHQF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtactcaacatattcagcaacttgaaaaacagtggcaggacgcgcgctggcag
ggcattacccgcccgtacagcgcagaggaagtgattaacctgcggggctctgttgtgccg
gcctgtactctggcagagcggggggcggtgaagctctggtcgctgctcaatggcgacgcc
aaaaaaggctatatcaacagtctgggagcattaacgggcggtcaggctctgcaacaggca
aaggccggtatagaagcgatctatctgtctggctggcaggtcgctgccgatgccaacgta
gcagggcaaatgtatccggatcagtcgctttatccggtcaactccgtgcctgaggtggtc
acccgtattaatcagacattccagcgcgccgatcagattcagtgggctaacggcacagaa
cctggggacagccgctatatcgactattttctgcctatagtcgccgatgcagaagcgggc
tttggtggcgtgctgaatgcgtttgaactgatgaagtcattgatcagcgcaggcgcggcg
gccgtgcactttgaagatcaactggcggcggtgaagaaatgcggtcatatgggcggtaag
gtgctggtgccaacccaggaggcgatacagaagctggtggcggcgcgtctggctgccgat
gtcatgggcgtacccacgatcctgctggcgcggaccgatgcggatgccgcagacctgatc
acgtctgactgtgacgaatacgaccgcccatttatacgcggcgaccgcacggcggaaggt
tttttccgcaccaacgccggcattgagcaggcaatcagccgtggactggcttacgcccct
tacgccgatgtcctttggtgtgaaacctccaccccggatttggtcatggcccagcgtttt
gccgatgcgattcacgcccgctatccaggcaagctgctggcttacaactgttcgccttcg
tttaactggaaaaagaatctggatgacaaaaccattgctgccttccagcaggcgctcagt
gacatgggctatcgctttcagttcattacgctggcgggcatccacagcatgtggttcaac
atgttcgatcttgcgcacgcttacgctcagggcgaaggcatgcgccactatgtggaaaaa
gttcagcagccggagtttgctgcgcgcgaacggggttacagcttttcatcgcatcagcag
gaggtcggaacaggctatttcgatcaggtgaccaacacgattcagggcggcaagtcatcg
gtgacggccctgacagggtccaccgaggagcatcagttttga

DBGET integrated database retrieval system