KEGG   Pantoea ananatis LMG 5342: PANA5342_4190Help
Entry
PANA5342_4190     CDS       T01728                                 

Gene name
aceA
Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PANA5342_4190 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PANA5342_4190 (aceA)
Enzymes [BR:plf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PANA5342_4190 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4419731..4421032)
Genome map
AA seq 433 aa AA seqDB search
MTRTQHIQQLEKQWQDARWQGITRPYSAEEVINLRGSVVPACTLAERGAVKLWSLLNGDA
KKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANVAGQMYPDQSLYPVNSVPEVV
TRINQTFQRADQIQWANGTEPGDSRYIDYFLPIVADAEAGFGGVLNAFELMKSLISAGAA
AVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTILLARTDADAADLI
TSDCDEYDRPFIRGDRTAEGFFRTNAGIEQAISRGLAYAPYADVLWCETSTPDLVMAQRF
ADAIHARYPGKLLAYNCSPSFNWKKNLDDKTIAAFQQALSDMGYRFQFITLAGIHSMWFN
MFDLAHAYAQGEGMRHYVEKVQQPEFAARERGYSFSSHQQEVGTGYFDQVTNTIQGGKSS
VTALTGSTEEHQF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtactcaacatattcagcaacttgaaaaacagtggcaggacgcgcgctggcag
ggcattacccgcccgtacagcgcagaggaagtgattaacctgcggggctctgttgtgccg
gcctgtactctggcagagcggggggcggtgaagctctggtcgctgctcaatggcgacgcc
aaaaaaggctatatcaacagtctgggagcattaacgggcggtcaggctctgcaacaggca
aaggccggtatagaagcgatctatctgtctggctggcaggtcgctgccgatgccaacgta
gcagggcaaatgtatccggatcagtcgctttatccggtcaactccgtgcctgaggtggtc
acccgtattaatcagacattccagcgcgccgatcagattcagtgggctaacggcacagaa
cctggggacagccgctatatcgactattttctgcctatagtcgccgatgcagaagcgggc
tttggtggcgtgctgaatgcgtttgaactgatgaagtcattgatcagcgcaggcgcggcg
gccgtgcactttgaagatcaactggcggcggtgaagaaatgcggtcatatgggcggtaag
gtgctggtgccaacccaggaggcgatacagaagctggtggcggcgcgtctggctgccgat
gtcatgggcgtacccacgatcctgctggcgcggaccgatgcggatgccgcagacctgatc
acgtctgactgtgacgaatacgaccgcccatttatacgcggcgaccgcacggcggaaggt
tttttccgcaccaacgccggcattgagcaggcaatcagccgtggactggcttacgcccct
tacgccgatgtcctttggtgtgaaacctccaccccggatttggtcatggcccagcgtttt
gccgatgcgattcacgcccgctatccaggcaagctgctggcttacaactgttcgccttcg
tttaactggaaaaagaatctggatgacaaaaccattgctgccttccagcaggcgctcagt
gacatgggctatcgctttcagttcattacgctggcgggcatccacagcatgtggttcaac
atgttcgatcttgcgcacgcttacgctcagggcgaaggcatgcgccactatgtggaaaaa
gttcagcagccggagtttgctgcgcgcgaacggggttacagcttttcatcgcatcagcag
gaggtcggaacaggctatttcgatcaggtgaccaacacgattcagggcggcaagtcatcg
gtgacggccctgacagggtccaccgaggagcatcagttttga

DBGET integrated database retrieval system