KEGG   Pantoea ananatis LMG 5342: PANA5342_4226Help
Entry
PANA5342_4226     CDS       T01728                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex alpha subunit
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00071  Fatty acid degradation
plf00280  Valine, leucine and isoleucine degradation
plf00281  Geraniol degradation
plf00310  Lysine degradation
plf00362  Benzoate degradation
plf00380  Tryptophan metabolism
plf00410  beta-Alanine metabolism
plf00640  Propanoate metabolism
plf00650  Butanoate metabolism
plf00903  Limonene and pinene degradation
plf00930  Caprolactam degradation
plf01040  Biosynthesis of unsaturated fatty acids
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01120  Microbial metabolism in diverse environments
plf01130  Biosynthesis of antibiotics
plf01200  Carbon metabolism
plf01212  Fatty acid metabolism
Module
plf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PANA5342_4226 (fadB)
   00650 Butanoate metabolism
    PANA5342_4226 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    PANA5342_4226 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    PANA5342_4226 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PANA5342_4226 (fadB)
   00310 Lysine degradation
    PANA5342_4226 (fadB)
   00380 Tryptophan metabolism
    PANA5342_4226 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PANA5342_4226 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PANA5342_4226 (fadB)
   00281 Geraniol degradation
    PANA5342_4226 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PANA5342_4226 (fadB)
   00930 Caprolactam degradation
    PANA5342_4226 (fadB)
Enzymes [BR:plf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PANA5342_4226 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PANA5342_4226 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PANA5342_4226 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PANA5342_4226 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CCF11619
Position
4474389..4476572
Genome map
AA seq 727 aa AA seqDB search
MLYQGANLTLNQLDDGIVELVFDAPGSVNKLDTQTVASLGEAIAVLEQHADLRGVLLSSA
KPAFIVGADITEFLALFDAPTEKLSQWLTFANSIFNRLEDLPVPTIAAIDGYALGGGCEC
VLATDLRVATPTARLGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDIDGMAALR
LGLVDAVVSPDKLRDAALTMLKAAASDGSWRARRAPKLAPLKLSPVEAAMSFTIAKGMVM
QTAGKHYPAPLTAVKTIEAAAALGRDDALKLETAAFVPLAQSDVARALVGIFLNDQYIKG
LAKKRSSENGAPKQAAVLGAGIMGGGISYQSAWKGVPVKMKDIHPQALTLGMNEASKLLN
KQLERGKIDGNRLAAVIATIQPTLDYAGFDQADVVVEAVVENPQIKASVLAETEKHMRSD
AILASNTSTIPISQLAQALQRPENFCGMHFFNPVPRMPLVEVVRGEKTSEATLGKVVAWA
SKMGKTPVVVNDCPGFFVNRVLFPYFAAFGMLLRDGADFRQIDKVMEKQFGWPMGPSWLL
DVVGIDTAHHAQSVMADGFPQRMKKDYRDAIDILFEAKRFGQKNGKGFWRWEEDKKGKPK
KVSDPEVDALLEPACQPKRIFSDEEILNRMMLPMLNEVVRCLEEKIIASPAEADMALVYG
LGFPPFRGGAFRYLDTLGNSNVVDQAKRYTALGGLYELPALLSEKARQHESWYPAVKPID
EAAFRSA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgctaacctcactcttaatcagttggacgacggcattgtcgagctg
gtgtttgatgcccccggctccgttaataagctggatacacaaaccgttgccagcctcggc
gaagcgattgctgtgctggagcaacacgccgatctgcgcggcgtgcttctgagctcagct
aaacccgcctttatcgttggggctgacatcaccgaattccttgcgctttttgacgcgcca
acggaaaagctgagccagtggctgacgttcgcaaacagcatttttaatcgtctggaagat
ttacccgttcccaccatcgccgcgatcgatggctacgcgctgggcggtggctgtgaatgt
gttctggcgacggacttacgggttgccacgccaaccgcccgcctgggcttacctgaaacc
aagctgggcatcatgccgggttttggcggcagcgttcgcctgcctcgcctgttgggtgct
gacagcgcgctggaaatcattgcggcaggtaaagatattgatggtatggctgcgctcagg
ctgggtctggtcgatgcagttgtcagccctgataaactgcgcgatgcagcgctgacgatg
cttaaagcggcagccagtgatggcagttggcgggcacgtcgcgcccctaaattagccccg
ttaaagctgagccctgtcgaggccgcaatgagctttacaatcgctaaaggcatggtcatg
caaacggccggaaaacattatcctgcgccgctcaccgccgtgaagacgatcgaggccgca
gccgcattaggacgtgacgatgcgttaaaactggaaacggcggcgtttgttccgttggcg
caatcggatgtggcccgcgcgctcgtcggaattttcctcaacgatcagtacattaaaggg
ctggcaaaaaaacgcagcagcgaaaatggtgcgccgaagcaggctgccgtgctgggcgcc
gggattatgggtggcggcatcagctatcagtcggcgtggaaaggtgtgccggtcaagatg
aaggatattcatccgcaggcgctgaccctgggcatgaacgaagccagtaagcttctgaac
aagcagctggagcgaggtaagatagacgggaataggctggctgccgtcattgccaccatt
caacccacgctggattatgccggatttgatcaggccgatgtcgtggtcgaagccgtggtc
gaaaatccacagatcaaagccagtgtgctggctgaaacagaaaagcatatgcgcagtgat
gccatcctggcctcgaatacctctacgatccccatcagccagctggcgcaggcactgcag
cgtcccgaaaacttttgcggtatgcacttctttaatccggttccccgtatgccgctggta
gaagtggttcgcggagagaaaaccagtgaagcgacgttgggtaaagtcgtggcatgggcc
agcaagatgggcaaaacccctgtcgtggtgaatgactgcccaggcttcttcgtaaaccgt
gttctgttcccttactttgccgcgttcggcatgttgttgcgcgatggtgcggatttccgc
caaatcgataaagtgatggaaaaacagtttggctggccgatgggcccttcctggctgctg
gatgtcgtagggattgataccgcacatcatgcgcaaagcgtgatggcggatggtttccca
cagcgtatgaaaaaggactatcgcgatgctatcgatattctgtttgaagcaaaacgcttt
ggtcagaaaaacggtaaaggcttctggcgttgggaagaagacaaaaaagggaaacctaaa
aaagtctctgatcccgaggtcgatgcgctgcttgaacctgcctgccagcctaagcggatc
ttcagtgatgaagaaatcctgaaccgcatgatgttgccaatgctgaatgaagttgtccgc
tgtctggaagagaagattattgcttcacctgccgaggcagacatggcgctggtgtacggc
ctgggattcccgccattccgtggtggggctttccgttatctcgacacgctggggaacagt
aatgtcgtggatcaggcgaaacgctatacggctctgggcggcctgtatgagctgcctgcc
ctgctgtcagaaaaagcgcgccaacatgaaagctggtaccccgccgtcaaaccgattgat
gaagccgcgttcagaagcgcctga

DBGET integrated database retrieval system