KEGG   Pantoea ananatis LMG 5342: PANA5342_p10043Help
Entry
PANA5342_p10043   CDS       T01728                                 

Gene name
ascB
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA5342_p10043 (ascB)
Enzymes [BR:plf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PANA5342_p10043 (ascB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pPANA10:complement(40128..41558)
Genome map
AA seq 476 aa AA seqDB search
MSEATFPEGFLWGGALSANQSEGAFLEGGKGLTTVDMIPIGPTRMPVKLGQEKRVELRDD
EFYPSHTAIDFYHRYREDIALMAEMGFTVFRTSIAWSRIFPRGDESTPNEQGLAFYRDMF
TECRKHGIEPLVTLCHFDVPMHLVTQYGSWRNRKMIEFFARYARTCFDAFDGLVKYWLTF
NEINIMLHSPFSGAGLVFEPGENSEQVKYQAAHHELVASALVTKIAHEINPDNQVGCMLA
GGNFYPWSSKPDDVWAALQKDRENLFFIDIQARGAYPAYAARLFREKGIQIEMADGDADI
LRHTVDFVSFSYYASRCASAEMNDNNSSAANVVKSLTNPHIQRSEWGWGIDPLGLRITMN
MMYDRYQKPLFLVENGLGARDELTEKGEIIDDYRISYLREHIRAMADAIGDGIPVIGYTT
WGCIDLIAASTGEMSKRYGFVYVDRDDRGEGTLARRRKKSFWWYKKVIASNGRDLD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcaacattccctgaaggctttttatggggcggtgccttatccgccaatcag
tcagaaggcgcttttcttgaaggcgggaaaggactcactaccgttgacatgatccccatt
ggccccacgcgtatgccagtaaagctggggcaggaaaaacgcgttgagttgcgcgatgac
gaattctatcccagccatactgcgatcgatttttatcatcgttatcgggaagacattgcc
ttgatggcagaaatgggctttaccgtctttcgcacctcaattgcgtggagccgtatcttt
ccgcgtggcgatgaaagcacgccgaatgaacagggcctggctttttatcgtgatatgttc
accgagtgtcgtaaacatggcattgaacctttagtgacgctctgccattttgacgttccc
atgcatttggttacgcaatacggttcgtggcgtaatcgtaaaatgattgagttttttgcc
cgctatgcccgcacctgttttgacgcatttgatgggttagtgaagtactggctgaccttt
aacgaaattaacatcatgctgcacagcccattttcgggtgccggattggtgtttgaaccc
ggtgaaaacagtgagcaggttaaatatcaggcagctcaccacgaactggtcgcgagcgcc
ttggtgacaaaaatcgcgcatgaaatcaaccctgataatcaggtgggatgcatgctggca
ggtggcaatttttatccctggtcgagcaaacctgacgatgtctgggcggcgctacaaaaa
gatcgtgaaaacctgtttttcattgatattcaggcgcgaggtgcttatcccgcctacgct
gcgcgccttttccgcgaaaaagggattcagattgaaatggcagacggtgatgcggatata
ctcaggcataccgtcgatttcgtgtcgttcagctattatgcatcccgatgtgcttcggcc
gagatgaatgacaacaatagcagcgcggcaaacgtggtgaaatccctcaccaacccgcat
attcagcggagtgaatggggctggggcatcgatccgcttggcctgcgcatcaccatgaat
atgatgtatgaccgttatcagaaaccgcttttcctggtcgagaatggcctgggcgcacgc
gatgagttaacggagaaaggcgaaattattgacgattatcgtatcagctacctgcgcgaa
catatccgggcgatggccgatgcgatcggagacggtattcctgttatcggctataccaca
tggggctgtatcgatttgattgccgcatcaaccggcgaaatgagcaaacgttacgggttc
gtttatgtggatcgtgacgatcgtggagaaggcacgctggcccggcggcggaaaaagtcc
ttctggtggtataaaaaggtgatagcaagtaacggcagggatttggattaa

DBGET integrated database retrieval system