KEGG   Pantoea ananatis LMG 5342: PANA5342_p10157Help
Entry
PANA5342_p10157   CDS       T01728                                 

Gene name
cga
Definition
glucoamylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PANA5342_p10157 (cga)
Enzymes [BR:plf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PANA5342_p10157 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pPANA10:complement(143225..145726)
Genome map
AA seq 833 aa AA seqDB search
MSNADSDAVPLQTCMKHDDPPLRAGVDAAPGRPGIEARWTSSAKSGIGTALSSDSRVWFT
LSHGVLNEIYYPRVDSACTRDCVFVITGPEGYFSEEKRDCLTETRPHSPGIPAFTITNTA
RDGLYRLEKDIITDPARDCVLQRVRFTALKGNVEHYTVTALLAPHLVNAGQMNAAWIGEF
DDKPVLFATGRSRYLALVCDIPWTAMSAGFVGMSDGWQQLKEQGRLVNQYRRADDGNVAL
AGELAFTSACSEATLAIGFGQTESEAAAAATASLNAGFDKARDGYIRNWQAWQDRLIPLD
QEARNGVNTYRVSTAVLASHRAADCPGAVVASLTIPWGFSKGDDDLGGYHLVWPRDLVET
AGGFLAAGDADQALAILEYLRRVQEPSGRWPQNLWLDGKPYWPGIQMDECAFPLLLMDML
RRLGYLDNKAQKRFMPMLRRAACYILTNGPATAEDRWEEDSGYSPFTLAVEIAALLAAAD
LLSIDGDEAAANHLRETADCWNEQIEKWTFAGDPHFCTSIGISGHYVRIAPSGATDEVSA
SGNTEIRNQTPDRALLPTADVLSPDALALVRFGLRAADDPHILDTIKAIDHSLRVDLPQG
PLWYRYTGDGYGEHADGAPFDGIGQGRPWPLLAGERAHYELAAGRHDAAEALLATLEKSA
GSGGLLPEQVWDGSDIPDKAMFFGRPSGSAMPLVWAHSEHIKLLRSLRDGAVFDMPPQGV
ERYIRNQTGSHLRIWRFNNRVSSLPVGKQLRLETEANALVHWSTDDWATVSDSPARSSGL
GTYYVDLPVQHETAGTRVVFTFYWPDVEHWENTDFTVHVVNEPNDQTRIGNGE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgctgacagcgacgccgtcccgttgcaaacgtgcatgaagcatgacgacccg
ccattacgcgcaggcgttgacgccgccccgggaaggccaggaattgaagcccgatggaca
tcgagtgccaagagcggaatcggcacggccctttcatcagactcgcgcgtctggttcacc
ttgagccacggcgttctcaacgaaatctattatccacgcgttgacagcgcctgtacccgc
gattgcgtcttcgttatcacggggcctgaaggttatttctccgaagaaaagcgcgactgc
ctgaccgaaacccgaccccactcgccaggcattccggccttcaccatcaccaacacggcg
cgtgacggcctctacaggcttgagaaggacatcattactgatccggcccgtgactgtgtg
ctgcagcgggtccgtttcaccgcgttgaaggggaacgttgagcattacaccgtcaccgca
ctgctcgctccccatctggtgaatgccggacaaatgaacgccgcctggatcggcgaattt
gacgataagccagtgcttttcgccaccggccgctcccgctatctggcgctcgtctgcgac
atcccctggacggcaatgagcgccgggtttgtcggtatgtcagacggctggcagcagctt
aaagaacagggacgccttgtgaaccaataccggcgggcagacgatggcaatgtcgcgctt
gccggagagctggcgttcaccagcgcctgcagtgaagccacgctggctattggtttcggc
caaacggaatccgaggccgcagcggcggcaaccgccagtcttaacgcgggctttgataaa
gcgcgcgatgggtatattcgcaactggcaagcgtggcaggacaggctcattccactcgat
caagaagcgcgaaacggcgtcaatacataccgggtttcaacggcggtactggcctcgcac
agagccgctgattgtcccggcgccgttgtcgcgagcctgacgataccctggggattttcg
aagggcgatgacgatcttggcggctatcatctggtctggccgcgagacctggtcgaaacg
gcagggggtttcctggccgcaggcgacgccgaccaggcactcgccattctggaatatctc
cgtcgtgttcaggagccctccgggcgctggccacagaacctgtggctggatggaaaaccc
tactggccaggcatccagatggatgagtgtgcattcccccttctgcttatggatatgctg
cgcagactcggctatctcgacaataaagcgcagaaacgctttatgcctatgctacgccgc
gcggcctgctacattttgaccaacggcccggcgaccgcggaggaccgctgggaggaagac
tcaggctacagtccgtttaccctggcggtcgagatcgctgcactgcttgccgccgcggat
ctgctttcgatagacggagatgaagcggcggcaaaccacctgcgagaaaccgcagactgc
tggaatgagcagattgaaaaatggacctttgccggggatccccatttttgcacctcgatt
ggcatttccggtcactatgtccgcatcgcgccgtcgggcgcaacggatgaggtcagcgca
tccggcaataccgagattcgcaaccagacaccggatcgggcgcttctgccgaccgctgat
gtgctgagcccggatgccctggcactggtgcgtttcggcctgcgtgcagcggacgacccg
cacatccttgatacgataaaggctattgaccacagtcttcgggtcgatttacctcagggg
ccattgtggtatcggtacaccggtgatggctatggcgaacacgcagacggcgcgccgttc
gacggtatcggccaggggcgtccctggcctctgctggcgggcgaacgcgcgcattacgag
ctggcagcgggcaggcacgacgcggctgaggcgctcctggccacgctggaaaaatcagca
ggctcgggcgggctgttaccggaacaggtatgggacggctccgatattcctgataaggcg
atgttcttcgggcgtccttccggtagcgccatgccgcttgtctgggcacattccgaacac
attaaactgctgcgatcgcttcgcgatggtgcggtcttcgatatgccaccgcaaggcgtt
gaacgctatatcaggaatcagaccggatcgcatttgcgcatatggcgctttaacaaccgc
gtatcctcccttcctgtcgggaagcaactgaggctggaaacggaagcgaacgccttggtg
cactggagtacggatgactgggctaccgtttctgactccccggcgcgctcatcggggctt
ggaacctattatgtggacctgcctgtacagcacgaaaccgcaggaacccgcgttgtcttt
accttttactggcctgacgttgaacattgggaaaacaccgattttaccgttcacgtcgta
aatgaaccgaacgatcaaacccgcattggcaatggagaatga

DBGET integrated database retrieval system