KEGG   Planctomyces limnophilus: Plim_0026Help
Entry
Plim_0026         CDS       T01225                                 

Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
plm  Planctomyces limnophilus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34097..35662
Genome map
AA seq 521 aa AA seqDB search
MPIRLVFPSVCSGNVHSERTVSLTAVAPRLYTRDGQFKTGALFTPYHDLTGTVTRAWHIF
ETHLPLKRFRKLCEVLRDLILKVAILLMLVLFIVQGSGASLSAQETASTCEVNATNREPE
TTASPSVALKPKARAVRSIEERSQHIQRLRKEYELPTSNWPAPAVDAGVKWRELGTIEAP
PVSALAPTSPAKIQLGRVLFFDPRLSRTKEMACASCHDPDLGWADGRMSAFGLGRTILAR
NTPSILNASLQPALFWDSRARNLEDQARQVLLNPKEMGATEADLIATLGNISEYRVLFQE
AFGSESVSLDRVSQAIAAFETTLLGGRSPFDRFLNGQSQALSDSALVGLDLFRREARCIN
CHHGPTFSDGQLHGLNISHYGNKREDLGRYNVTGAAQDSGLFRTPSLRNVTATGPYMHSG
LFELDELLTLYNAGMPRTPHANDNSKTPRSSQYSGTKPLPVKSPLLKPLGLNSQDLQDLA
SFLEALAEPRIRIRPPELPASDSQRELTNQKAASRPADESS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgccgatccgtctcgtatttccaagcgtctgctcaggcaatgttcactcggaacgtaca
gtttctttgacagcagttgccccacgtctttatacacgagacggtcagtttaagactggc
gcgcttttcacaccgtatcatgacctcactggcactgtgaccagggcatggcacattttt
gaaacccatttgccgctcaagaggtttcgaaaactttgcgaggttctccgagatttgatt
ctaaaggtcgccattctcctgatgctggtattgttcatcgttcaagggtctggtgcatcg
ttatcggctcaggagactgcatccacttgtgaggtaaacgctacgaatcgtgagcccgag
acaaccgcttcgccatctgtagcgcttaagccgaaagccagggccgttcgttctatcgag
gaacgctctcagcacattcagcggctacgcaaagagtatgaacttcccacttcgaactgg
cctgcccctgctgttgatgccggagtcaaatggcgtgaactcgggacaatcgaagctcca
ccagtctcggcactggcaccgacatcgcccgcgaagattcaactgggtcgagtgctcttt
tttgaccctcgactttcacggacgaaggaaatggcttgcgcctcctgccacgatcccgat
ctgggatgggctgacggtcgcatgtcggccttcggactggggcgaaccattctggcacgc
aatactcccagcatcctcaatgcttcgttacaacctgcattattctgggatagtcgagcc
cggaatctggaggatcaggccagacaggtccttttgaaccctaaagaaatgggagcgaca
gaagctgacctgatcgcgacgctcggcaatatctctgagtatcgcgttctctttcaggaa
gcatttgggagcgaatcggtttctctggatcgagtttcgcaagcgattgctgcgttcgaa
accactcttctggggggacgcagtcctttcgatcgattcctgaatggacaaagccaggca
ctttctgattctgcacttgtggggctcgatctgtttcggcgcgaagcccgctgtatcaat
tgccaccatggcccgacgttttccgatggtcagctgcatggcctgaatatcagtcattac
ggcaacaaacgcgaagatctgggtcgttacaacgtgaccggagctgctcaggattcgggc
ctgtttcggacgccgtcactgcgtaatgtcaccgccactggcccttacatgcattccggc
ctctttgaactggatgaactgctgacactgtacaacgccggcatgcccagaacccctcat
gccaacgacaactccaaaacaccacgatccagtcaatactccggcactaagcctcttcca
gtcaaaagcccattgctgaaacctttgggtttgaacagccaggatcttcaggatctggcc
agttttctggaagcgctggccgaacctcgtattcgtattcgaccaccagaacttccagcg
tctgattcccagagggagctgaccaatcaaaaagctgccagccgacctgcggatgaaagt
tcgtaa

DBGET integrated database retrieval system