KEGG   Planctomyces limnophilus: Plim_0062Help
Entry
Plim_0062         CDS       T01225                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
plm  Planctomyces limnophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plim_0062
   01230 Biosynthesis of amino acids
    Plim_0062
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plim_0062
   00030 Pentose phosphate pathway
    Plim_0062
   00051 Fructose and mannose metabolism
    Plim_0062
   00052 Galactose metabolism
    Plim_0062
  Energy metabolism
   00680 Methane metabolism
    Plim_0062
Enzymes [BR:plm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Plim_0062
Protein phosphatases and associated proteins [BR:plm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Plim_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(78961..79995)
Genome map
AA seq 344 aa AA seqDB search
MKVGILTGGGDCPGLNAVIRGAVRVIGNAGGEVIGLQRGWRGAIDGIGTPLTLENTADIL
WKGGTILGSSRTNPYKNPEDVKKLLASYERLGLDALIAIGGDDTLGVANKLYNDHKLNTI
GCPKTIDNDLSCTDVTFGFDTSINICMESIDRLRTTAESHQRIIVVETMGRHAGWIACEA
GMAGSADYILVPEMKVDIEAMCNVLKKRREAGKMWGIVVASEGAVIAPEEGYVTSNAKVD
DFGHVSLGGVGELVASIIEKRTGIETRHVILGHLQRGGTPSAYDRVLGTRLGVGAGRLVI
AKKFGRMVALQGTSIVDVALQDAVGKLKTLDPSFYQDAAEFFTV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttggaattctcactggcggtggagattgccccggcttgaatgccgtcattcgt
ggtgcagtccgggtgattggcaatgcaggtggcgaagtcattggcctgcagcgcggctgg
cgcggtgctatcgacgggattggcacgccactgacgctggagaataccgcggacattctc
tggaagggtggcaccattctgggttcttcccgtaccaacccttacaagaacccagaagat
gtcaaaaagctgctggccagttacgagcggttgggcctcgatgctctgattgccattggt
ggtgacgacacgttgggcgtggccaataaactctataacgaccacaagctcaatacgatt
ggctgccccaagacgatcgacaacgatctctcctgcaccgatgtgaccttcggttttgac
acttcgattaacatctgtatggagtcgattgatcgtttgcggacgacggccgaatcgcac
cagcggatcatcgtcgtggaaacgatgggacgccacgcgggctggattgcctgcgaagcc
gggatggctggctctgcagactacattcttgttccggaaatgaaggtcgatatcgaggcc
atgtgcaacgtcctcaagaaacgtcgcgaagccggcaaaatgtggggcatcgtggtcgcc
agtgaaggagctgtgattgcaccagaagaaggctatgtcacatcgaatgccaaggtcgac
gacttcgggcatgtcagcctgggtggtgtcggcgaactggtggcctcgatcattgaaaag
cggacaggaatcgaaacccgccatgtgattctcggacacctccagcgtggtggcacacca
tcagcttatgatcgtgttctcggaacacgtctgggtgtgggagccgggcgactggtcatc
gcgaagaagtttggccggatggtggctctgcagggaacatcgattgtggacgtcgcactg
caggatgccgtcggcaagctgaagacactcgacccgtcattttatcaggatgctgccgag
ttcttcacagtctag

DBGET integrated database retrieval system