KEGG   Planctomyces limnophilus: Plim_0186Help
Entry
Plim_0186         CDS       T01225                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
plm  Planctomyces limnophilus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240918..242204
Genome map
AA seq 428 aa AA seqDB search
MPHVQHRECKLPSISTRLQKTDLPAVFLAMVTLWLGLELPPVFAQPRDPYLAPRHQMVTE
FIEREGVKNPRVLSSMRQVPRHEFVLPTQKQQAYFDQAMPIGHKQTISPPYIVAYETEAI
DPQPTDKVLEIGTGSGYQAAVLSNLVQEVYTIEIVEPLGKTAAERLKRLGYNNVKVKVGD
GYQGWAEHAPFDKILVTCSPEDVPKPLVDQLKEGGKMIIPLGERYQQVFHLMEKKDGQMI
SQKLIPVLFVPMTGAAEDERKVKPDPMHPQLVNGDFETDENNDGMVDHWYYQRQVKLETA
DVHGGKVAVTLSNSEPGRMAQLVQGMPVDGIRLGTMDVSLWAKAKGLRSSRDGNERPELS
VIFFDDLRRTVAEVSVPISTGTYEWQEFRKSFAIPTKAREAIIFMSLQGATGDLTIDDLQ
IRTPFRKP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacgttcaacatcgggaatgcaaacttccttcgatatcaactcggctccagaag
acggatttgccagccgttttcttggcgatggtgacgttgtggctgggtttggaactgccg
ccggttttcgcacagccgcgtgacccgtacctggcaccccggcatcagatggtcaccgag
ttcattgaacgcgaaggggtcaagaatccgcgtgtgctctcgtcgatgcgtcaagtgcct
cgtcatgagttcgtgttgccgactcaaaagcagcaggcctatttcgaccaggccatgccg
attggccataagcagacgatttctcccccttacattgtggcctatgagaccgaagccatt
gatccacagccgaccgataaggtgctcgaaatcgggacgggaagtggctatcaggcggct
gtgctttcaaatctggtgcaggaggtctacacgatcgagattgtggagccactaggaaag
accgccgccgaacgtctgaaaaggctgggctataacaatgtgaaggtgaaggtgggcgat
ggctaccaggggtgggccgagcatgccccgttcgacaaaattctggtgacctgctccccc
gaggatgtacccaagccgctggttgatcaactcaaggaaggtggcaaaatgatcatcccc
ttaggagaacgataccagcaggtctttcatctcatggagaagaaagacggccagatgatc
agccagaagctgattcctgtgctgtttgtcccgatgaccggtgccgccgaagatgagcgc
aaggtcaagcctgatcccatgcatcctcaactggtgaatggcgactttgaaacggatgaa
aacaatgacggcatggtcgatcactggtattaccagcgacaggtgaagctcgaaacggcc
gacgtacatggtggcaaagtggccgtgacgctcagtaacagcgagcccggtcgtatggcg
caactggtgcaagggatgcctgtcgacgggattcgtctggggacgatggatgtcagctta
tgggccaaggccaaaggcttgcggtcgagccgggatgggaacgagcggcccgagctatcg
gtgattttctttgatgacctccgccggacagtggccgaggtcagcgtgccgatctcgacg
ggaacttacgaatggcaggagtttcgcaagagctttgccattcccaccaaagcccgggaa
gccatcatttttatgagccttcaaggagcgacaggcgacttaacgatcgacgacctgcag
attcgcacaccgtttcggaagccgtag

DBGET integrated database retrieval system