KEGG   Planctomyces limnophilus: Plim_0413Help
Entry
Plim_0413         CDS       T01225                                 

Definition
glycoside hydrolase family protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
plm  Planctomyces limnophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Plim_0413
Enzymes [BR:plm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Plim_0413
Exosome [BR:plm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Plim_0413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
519606..521519
Genome map
AA seq 637 aa AA seqDB search
MVPANVSVENRVSVENQASKPSETAPHHAGMGAILTQQGVAFRVWAPHAEAVSVVGDFND
WQETRHPLSQEYREQLEDHEQAGTAPESVASGFWYGEVTGLSVGAEYLYALKLGEKWMTR
IDPYAKEVTNSVGHAVVTDPHFDWQNDAFELPPRNELIIYEMHIGTFAKDAGDGQPGTLS
SAIRQLDHLRRTGVNCVEIMPLAEFAGDFSWGYNPAHIFAVESSYGGPKAFKEFVREAHQ
RGIGVILDVVYNHFGPSDLSLWQFDGWNENQLGGIYFYNDWRAETPWGSTRPDYGRPEVR
QYLCDNALHWLEDFHCDGLRFDMTLYIRSVRGDGDPGGDLPDGWSLTQWINREIHARHPQ
ALTIAEDLHNKDDLTAPVERGGAAFSAQWDARFVHPVREVLIEPDDDDRSLDSIKGAIFA
TFNGDPFERVIYTESHDEVANGKARIPSEVMPLETRNWFAQKRATLGLALVMTTPGIPMV
FQGQEFLEDGWFRDDVPLDWDKAIELKGILRLFRDLCHLRLNNKGVSRGLTGSGLALLYE
DHTAKTLVFHRWHTPAPHDDIVVILNFYREPRQVEFNFPNAATWQLELNSDARIYSPEFA
NTPCIDQLNLQDEATNPAHHVSLEVGPYSALIFSRQT
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggttccagcgaacgtctctgttgaaaatcgtgtatcggttgaaaatcaggcatcgaaa
ccatcagaaacggctcctcatcatgcgggcatgggggcgattcttacacaacaaggtgtg
gccttccgtgtttgggcaccacacgccgaggccgtctctgtggtgggagacttcaacgac
tggcaggagactcgacatccactttcccaggagtaccgcgagcaattggaagatcatgag
caggcaggaactgctccagaatctgtcgcaagtggtttctggtacggcgaagtcacaggg
ctcagtgtcggtgcagagtatttgtacgccttaaaacttggcgagaagtggatgacgcgc
attgacccctacgcgaaagaggtcacgaattccgtgggtcacgccgtcgtgacagatcct
cattttgactggcagaacgatgccttcgaactgccacccaggaacgaacttatcatttat
gagatgcatattggcaccttcgccaaagatgccggcgatggccagcctggaacactttct
tcagcaattcgccagctcgatcatctcagacgcacgggtgtaaactgtgtcgaaatcatg
cctctggcagaattcgctggcgatttctcctggggttacaatcctgctcacattttcgct
gtcgagtcgagttatggcgggccgaaagcctttaaggagttcgttcgcgaagctcatcaa
agaggcatcggggtcattcttgatgttgtctacaatcacttcggtccatctgatctgagt
ctatggcaattcgatggctggaatgaaaatcaactcggcggtatctacttctataacgac
tggcgagctgaaactccctggggcagcacccgcccggattacggccgacccgaggttcga
caatacctgtgtgataatgcactccactggcttgaagactttcattgcgatggcctccgc
tttgatatgacgttatatattcgcagtgtgcgtggcgatggcgaccccggcggtgatctc
cctgatgggtggtctctaacgcagtggatcaatcgcgaaatccatgcgcgccatccccag
gccctgacaatcgcggaagatcttcacaataaagatgatctgacagcacccgtcgaacga
ggcggagctgccttctccgcgcagtgggatgccaggtttgttcatccagtacgagaagtc
ctgattgaacccgatgatgatgaccgttcactcgattccattaagggggccatcttcgcc
actttcaacggcgacccatttgaacgtgtcatctataccgaatctcacgatgaggtagca
aacggcaaagcccgcatcccttcagaagtcatgccgctcgaaactcgcaactggtttgcc
cagaagcgcgccactttaggcctcgccctggtcatgacaacccccggaattccaatggtc
tttcaaggacaggaatttctggaagacggctggttccgcgacgacgtgccactcgactgg
gataaagctattgaactcaaaggaattctccggctattccgggatctttgccacttgaga
ctcaataacaaaggcgtctctcgcggattgacaggttcaggacttgcactgctatatgaa
gaccacaccgctaaaacattagtattccaccgctggcatacaccagccccacacgacgat
atagtagtgatcctcaatttttaccgcgaaccccggcaggtcgagttcaatttccctaat
gcagcgacctggcaactggaattgaattcagacgccaggatttacagtccagaattcgcc
aatacgccctgtatcgatcagctgaatctgcaggatgaagccaccaatccagctcaccat
gtttcgctcgaagtcggcccttactcggccttgatcttttcgcgtcaaacgtag

DBGET integrated database retrieval system