KEGG   Planctopirus limnophila: Plim_0621Help
Entry
Plim_0621         CDS       T01225                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
plm  Planctopirus limnophila
Pathway
plm00020  Citrate cycle (TCA cycle)
plm00310  Lysine degradation
plm01100  Metabolic pathways
plm01110  Biosynthesis of secondary metabolites
plm01120  Microbial metabolism in diverse environments
plm01130  Biosynthesis of antibiotics
plm01200  Carbon metabolism
Module
plm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plim_0621
  Amino acid metabolism
   00310 Lysine degradation
    Plim_0621
Enzymes [BR:plm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Plim_0621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_D23 BAT HlyD_3 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ADG66468
UniProt: D5SR00
Position
complement(802893..804146)
Genome map
AA seq 417 aa AA seqDB search
MPVEVKVPSFGDSIVEVVIGQWFKKVGEAISPDDELVEVESEKSTLPIVATHGGVLQEIL
AQPGETVAVGAVVARLADAGAVVSAPAAPPAASASTPPATNGTGPAPSATTSETIVMPAA
ARALAEKGLSAADVTASGPGGRLLKEDVLRHSGTPAPVPAPAAPKPAPAPAPSTIVTTTT
APAGERVVRRQPLTTIRKRIAQRLVEAQHNAALLTTFNEIDMSAAMALRKEYQDKFVEKY
GIKLGFMSFFVKATINALLAYPAINAEIQGGDIVMHDYVDMGIAVGGGKGLVVPVIRSAE
KLSFAEIEMSINKLAKRAMENSLKPQDLEGGTFTISNGGVYGSLLSTPIVNPPQSGVLGM
HSIQERAMVVNGQIVARPMMYVALTYDHRIVDGKEAVSFLKRIKECVESPLRLMLEV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcgaagtgaaggttcccagtttcggcgactccattgtggaagtcgtcattggt
cagtggttcaaaaaagtgggtgaagcgatttcgcccgatgatgaactggtcgaggtcgaa
agtgaaaaatcgacactccccattgtggccactcatggtggtgtgcttcaggaaattctg
gctcagcctggcgaaacggtcgccgttggggccgttgtcgcgcgactggccgatgccggt
gctgtcgtcagcgcacctgctgctcctccagccgcttccgccagcaccccacctgccacc
aatggcaccgggcctgctccttcggcaacaaccagtgaaacgattgtgatgccagccgca
gcccgggcactggccgaaaaaggtctctctgctgccgatgtcactgccagtggacccggt
ggtcgcctgcttaaggaagacgtcctgcggcacagcggtacccctgcaccagttccagca
cctgctgctcctaaaccagcacctgcacccgcaccatccacaattgtcacgacaaccact
gcacctgccggtgaaagagtggtgcgtcgccagccgctcaccaccattcgcaaacgtatt
gcccaacgactggtcgaggctcagcacaatgccgccttgctgacgacgttcaatgaaatt
gatatgtccgcagctatggctctgcgcaaagaataccaggacaaattcgtcgagaaatac
ggcatcaagctgggcttcatgtcgttcttcgtgaaagccaccatcaacgctctgctcgct
tatccggcgatcaatgccgagattcagggtggcgatatcgtcatgcacgattatgtcgat
atgggtattgccgtcggtggcggtaaagggcttgtcgtgcctgtcattcgcagtgccgaa
aagctctcctttgccgagatcgaaatgtcgatcaacaaactcgccaaacgagccatggag
aattctctgaagcctcaagatctcgaaggcgggacattcaccatctccaatggtggcgtt
tacggctcattgctctcgactccgattgtcaatcccccacaaagtggtgtcctcgggatg
cactcgattcaggaacgggcgatggtcgtcaacgggcaaattgtggctcgtcccatgatg
tacgtcgcgctcacttatgatcatcggattgtcgatggcaaagaagccgtcagcttcctc
aagcgaattaaggaatgtgtcgagtctccactccggctgatgctcgaagtttag

DBGET integrated database retrieval system